You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ASF1B
Histone chaperone ASF1B

Protein Summary
Description
Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly. Cooperates with chromatin assembly factor 1 (CAF-1) to promote replication-dependent chromatin assembly. Does not participate in replication-independent nucleosome deposition which is mediated by ASF1A and HIRA. Required for spermatogenesis. This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263382
  • ENSP00000263382
  • ENSG00000105011

Symbol
  • CIA-II
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.9
transcription factor binding site profile
0.87
histone modification site profile
0.73
transcription factor perturbation
0.68
kinase perturbation
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.24   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 229   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.24   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 229   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (9)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (305)
1 – 10 of 305
CDAN1
Tbio
Novelty: 0.00149492
p_int: 0.999999996
p_ni: 3e-9
p_wrong: 1e-9
Score: 0.707
Data Source: BioPlex,STRINGDB
C15orf41
Tdark
Novelty: 0.20725389
p_int: 0.999999995
p_ni: 2e-9
p_wrong: 3e-9
Score: 0.186
Data Source: BioPlex,STRINGDB
CABIN1
Tbio
Novelty: 0.00039531
p_int: 0.99999999
p_ni: 9e-9
Score: 0.574
Data Source: BioPlex,STRINGDB
UBN1
Tbio
Novelty: 0.02634878
p_int: 0.999999989
p_ni: 3e-9
p_wrong: 8e-9
Score: 0.483
Data Source: BioPlex,STRINGDB
UBN2
Tdark
Novelty: 0.16216216
p_int: 0.999999983
p_ni: 1.7e-8
p_wrong: 1e-9
Score: 0.266
Data Source: BioPlex,STRINGDB
HIRA
Tbio
Novelty: 0.02024297
p_int: 0.999999957
p_ni: 2e-8
p_wrong: 2.3e-8
Score: 0.921
Data Source: BioPlex,STRINGDB
PAN3
Tdark
Family: Kinase
Novelty: 6
p_int: 0.999999783
p_ni: 2.17e-7
Score: 0.205
Data Source: BioPlex,STRINGDB
TLK1
Tchem
Family: Kinase
Novelty: 0.04102024
p_int: 0.999999512
p_ni: 4.88e-7
Score: 0.992
Data Source: BioPlex,STRINGDB
PAN2
Tbio
Family: Enzyme
Novelty: 0.16901408
p_int: 0.999999187
p_ni: 2.69e-7
p_wrong: 5.45e-7
Score: 0.291
Data Source: BioPlex,STRINGDB
TONSL
Tbio
Novelty: 0.10321447
p_int: 0.999997825
p_ni: 0.000002174
Score: 0.739
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  11.24

PubMed score by year
PubTator Score  11.44

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRH
1-70
MFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNIL
70-140
ASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI
140-202
MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALADDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFHINWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI