You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PARVA
Alpha-parvin

Protein Summary
Description
Plays a role in sarcomere organization and in smooth muscle cell contraction. Required for normal development of the embryonic cardiovascular system, and for normal septation of the heart outflow tract. Plays a role in sprouting angiogenesis and is required for normal adhesion of vascular smooth muscle cells to endothelial cells during blood vessel development (By similarity). Plays a role in the reorganization of the actin cytoskeleton, formation of lamellipodia and ciliogenesis. Plays a role in the establishement of cell polarity, cell adhesion, cell spreading, and directed cell migration. This gene encodes a member of the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival. [provided by RefSeq, Dec 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000334956
  • ENSP00000334008
  • ENSG00000197702

Symbol
  • MXRA2
  • MXRA2
  • CH-ILKBP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
1
virus perturbation
1
trait
0.97
interacting protein
0.91
transcription factor perturbation
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 234.91   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 234.91   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (8)
1 – 5 of 8
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (27)
Cell junction organization (R-HSA-446728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell junction organization
Reactome
Cell-Cell communication
Reactome
Cell-extracellular matrix interactions
Reactome
Localization of the PINCH-ILK-PARVIN complex to focal adhesions
Reactome
Regulation of cytoskeletal remodeling and cell spreading by IPP complex components
Name
Explore in Pharos
Explore in Source
Cell junction organization
Cell-Cell communication
Cell-extracellular matrix interactions
Localization of the PINCH-ILK-PARVIN complex to focal adhesions
Regulation of cytoskeletal remodeling and cell spreading by IPP complex components
Gene Ontology Terms (19)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (126)
1 – 10 of 126
ILK
Tchem
Family: Kinase
Novelty: 0.00174752
p_int: 1
Score: 0.999
Data Source: BioPlex,STRINGDB
LIMS1
Tbio
Novelty: 0.00724253
p_int: 1
Score: 0.996
Data Source: BioPlex,STRINGDB
RSU1
Tbio
Novelty: 0.02680644
p_int: 1
Score: 0.934
Data Source: BioPlex,STRINGDB
PARVB
Tbio
Novelty: 0.05250438
p_int: 0.999999936
p_wrong: 6.4e-8
Score: 0.985
Data Source: BioPlex,STRINGDB
MOCOS
Tbio
Family: Enzyme
Novelty: 0.08382676
p_int: 0.999984208
p_ni: 0.000015776
p_wrong: 1.5e-8
Score: 0.303
Data Source: BioPlex,STRINGDB
IQGAP1
Tbio
Family: Enzyme
Novelty: 0.00482573
p_int: 0.989495824
p_ni: 0.010504176
Score: 0.271
Data Source: BioPlex,STRINGDB
GCA
Tbio
Novelty: 0.01013108
p_int: 0.98390941
p_ni: 0.015684411
p_wrong: 0.00040618
Score: 0.281
Data Source: BioPlex,STRINGDB
DDX47
Tbio
Family: Enzyme
Novelty: 0.11163735
p_int: 0.944349302
p_ni: 0.055650658
p_wrong: 4e-8
Score: 0.242
Data Source: BioPlex,STRINGDB
LPXN
Tbio
Novelty: 0.00609819
p_int: 0.942281116
p_ni: 0.057718381
p_wrong: 5.03e-7
Score: 0.519
Data Source: BioPlex,STRINGDB
VPS11
Tbio
Novelty: 0.00679612
p_int: 0.914698613
p_ni: 0.085247832
p_wrong: 0.000053555
Score: 0.19
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  234.91

PubMed score by year
PubTator Score  22.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDP
1-70
EDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEK
70-140
LNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDH
140-210
VSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLN
210-280
LEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIV
280-350
NCDLKSTLRVLYNLFTKYRNVE
350-372
MATSPQKSPSVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSELQEEGMNAINLPLSPIPFELDPEDTMLEENEVRTMVDPNSRSDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEKLNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKSLVAILHLLVALSQYFRAPIRLPDHVSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLFTKYRNVE