You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
TDP1
Tyrosyl-DNA phosphodiesterase 1

Protein Summary
Description
DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 3'-phosphodiester bond, giving rise to DNA with a free 3' phosphate. Catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase I active site tyrosine residue. Hydrolyzes 3'-phosphoglycolates on protruding 3' ends on DNA double-strand breaks due to DNA damage by radiation and free radicals. Acts on blunt-ended double-strand DNA breaks and on single-stranded DNA. Has low 3'exonuclease activity and can remove a single nucleoside from the 3'end of DNA and RNA molecules with 3'hydroxyl groups. Has no exonuclease activity towards DNA or RNA with a 3'phosphate. The protein encoded by this gene is involved in repairing stalled topoisomerase I-DNA complexes by catalyzing the hydrolysis of the phosphodiester bond between the tyrosine residue of topoisomerase I and the 3-prime phosphate of DNA. This protein may also remove glycolate from single-stranded DNA containing 3-prime ph ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000335725
  • ENSP00000337353
  • ENSG00000042088
  • ENST00000393454
  • ENSP00000377099
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.86
kinase perturbation
0.81
transcription factor binding site profile
0.69
molecular function
0.67
tissue
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 162.5   (req: < 5)
Gene RIFs: 54   (req: <= 3)
Antibodies: 309   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 162.5   (req: >= 5)
Gene RIFs: 54   (req: > 3)
Antibodies: 309   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 752
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 27
Active Ligands (752)
1 – 10 of 752
CHEMBL240773
chemical structure image
CHEMBL18840,CHEMBL1256863
chemical structure image
CHEMBL29097
chemical structure image
CHEMBL51085
chemical structure image
CHEMBL297453
chemical structure image
CHEMBL18772
chemical structure image
CHEMBL164
chemical structure image
CHEMBL6246
chemical structure image
CHEMBL273481,CHEMBL1256363
chemical structure image
CHEMBL177756
chemical structure image
Protein Data Bank (14)
1 – 5 of 14
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
DNA Double-Strand Break Repair (R-HSA-5693532)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
DNA Double-Strand Break Repair
Reactome
DNA Repair
Reactome
Nonhomologous End-Joining (NHEJ)
Name
Explore in Pharos
Explore in Source
DNA Double-Strand Break Repair
DNA Repair
Nonhomologous End-Joining (NHEJ)
Protein-Protein Interactions (90)
1 – 10 of 90
POLB
Tchem
Family: Enzyme
Novelty: 0.00031442
p_int: 0.999999978
p_ni: 2e-8
p_wrong: 2e-9
Score: 0.831
Data Source: BioPlex,STRINGDB
CETN1
Tbio
Novelty: 0.01870324
p_int: 0.999999547
p_ni: 3.57e-7
p_wrong: 9.6e-8
Score: 0.194
Data Source: BioPlex,STRINGDB
CSNK1D
Tchem
Family: Kinase
Novelty: 0.00585669
p_int: 0.99975629
p_ni: 0.000242081
p_wrong: 0.000001628
Score: 0.186
Data Source: BioPlex,STRINGDB
APLF
Tbio
Novelty: 0.01671154
p_int: 0.99969278
p_ni: 0.000304918
p_wrong: 0.000002303
Score: 0.776
Data Source: BioPlex,STRINGDB
XRCC6
Tbio
Novelty: 0.0013086
Score: 0.968
Data Source: STRINGDB
XRCC5
Tbio
Novelty: 0.0019774
Score: 0.955
Data Source: STRINGDB
PRKDC
Tchem
Family: Kinase
Novelty: 0.00132843
Score: 0.948
Data Source: STRINGDB
TOP1
Tclin
Family: Enzyme
Novelty: 0.00022752
Score: 0.945
Data Source: STRINGDB
APTX
Tbio
Novelty: 0.00941154
Score: 0.928
Data Source: STRINGDB
DCLRE1C
Tbio
Novelty: 0.00510592
Score: 0.925
Data Source: STRINGDB
Publication Statistics
PubMed Score  162.50

PubMed score by year
PubTator Score  112.12

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDS
1-70
VLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKE
70-140
EEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDW
140-210
LVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIH
210-280
TSNLIHADWHQKTQGIWLSPLYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSET
280-350
NVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESM
350-420
LTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNA
420-490
MPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGLDSFKVKQKFF
490-560
AGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDTHGNMWVPS
560-608
MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQKTQGIWLSPLYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSETNVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESMLTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNAMPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGLDSFKVKQKFFAGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDTHGNMWVPS