You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
PLCXD1
PI-PLC X domain-containing protein 1

Protein Summary
Description
This gene is the most terminal protein-coding gene in the pseudoautosomal (PAR) region on chromosomes X and Y. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000381657
  • ENSP00000371073
  • ENSG00000182378
  • ENST00000381663
  • ENSP00000371079
  • ENST00000399012
  • ENSP00000381976

Symbol
  • LL0XNC01-136G2.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.96
PubMedID
0.7
histone modification site profile
0.62
metabolite
0.57
tissue sample
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.05   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 155   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.05   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 155   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (26)
1 – 10 of 26
GTPBP6
Tdark
Novelty: 0.07321538
Score: 0.775
Data Source: STRINGDB
PPP2R3B
Tbio
Family: Enzyme
Novelty: 0.03678679
Score: 0.71
Data Source: STRINGDB
DHRSX
Tdark
Family: Enzyme
Novelty: 0.84142395
Score: 0.649
Data Source: STRINGDB
SHOX
Tbio
Family: TF
Novelty: 0.00314396
Score: 0.62
Data Source: STRINGDB
SERINC5
Tbio
Novelty: 0.02385788
Score: 0.614
Data Source: STRINGDB
ASMTL
Tdark
Family: Enzyme
Novelty: 0.52194543
Score: 0.591
Data Source: STRINGDB
SPRY3
Tbio
Novelty: 0.10243032
Score: 0.531
Data Source: STRINGDB
NMT1
Tchem
Family: Enzyme
Novelty: 0.00436862
Score: 0.527
Data Source: STRINGDB
P2RY8
Tbio
Family: GPCR
Novelty: 0.08044634
Score: 0.504
Data Source: STRINGDB
AKAP17A
Tbio
Family: Enzyme
Novelty: 0.01392057
Score: 0.494
Data Source: STRINGDB
Publication Statistics
PubMed Score  2.05

PubMed score by year
PubTator Score  0.96

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLN
1-70
KALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEW
70-140
LERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIVSYEDESSLRR
140-210
HHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRL
210-280
SAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC
280-323
MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLNKALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEWLERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIVSYEDESSLRRHHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRLSAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC