You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ATG3
Ubiquitin-like-conjugating enzyme ATG3

Protein Classes
Protein Summary
Description
E2 conjugating enzyme required for the cytoplasm to vacuole transport (Cvt), autophagy, and mitochondrial homeostasis. Responsible for the E2-like covalent binding of phosphatidylethanolamine to the C-terminal Gly of ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A). The ATG12-ATG5 conjugate plays a role of an E3 and promotes the transfer of ATG8-like proteins from ATG3 to phosphatidylethanolamine (PE). This step is required for the membrane association of ATG8-like proteins. The formation of the ATG8-phosphatidylethanolamine conjugates is essential for autophagy and for the cytoplasm to vacuole transport (Cvt). Preferred substrate is MAP1LC3A. Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of ATG12 to itself, ATG12 conjugation to ATG3 playing a role in mitochondrial homeostasis but not in autophagy. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3. Promotes primary ciliogenesis by removing OFD1 from centriolar ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000283290
  • ENSP00000283290
  • ENSG00000144848
  • ENST00000402314
  • ENSP00000385943

Symbol
  • APG3
  • APG3L
  • APG3
  • APG3L
  • PC3-96
  • APG3-LIKE
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.99
histone modification site profile
0.88
transcription factor perturbation
0.8
hub protein
0.75
tissue sample
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 91.8   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 638   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 91.8   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 638   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
Autophagy (R-HSA-9612973)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Autophagy
Reactome
Cellular responses to external stimuli
Reactome
Macroautophagy
Name
Explore in Pharos
Explore in Source
Autophagy
Cellular responses to external stimuli
Macroautophagy
Protein-Protein Interactions (134)
1 – 10 of 134
ATG7
Tbio
Novelty: 0.00164436
p_int: 0.999999999
p_ni: 1e-9
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
ATG5
Tbio
Novelty: 0.00108428
p_int: 0.99999999
p_ni: 7e-9
p_wrong: 2e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
ATG16L1
Tbio
Novelty: 0.00474887
p_int: 0.999999981
p_ni: 1.7e-8
p_wrong: 1e-9
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
ATG12
Tbio
Novelty: 0.00558483
p_int: 0.999982687
p_ni: 1.5e-8
p_wrong: 0.000017297
Score: 0.999
Data Source: BioPlex,STRINGDB
GABARAP
Tbio
Novelty: 0.00551921
p_int: 0.999954646
p_ni: 0.000042955
p_wrong: 0.000002398
Score: 0.995
Data Source: BioPlex,STRINGDB
MAP1LC3B2
Tdark
Novelty: 0.50816697
p_int: 0.999884272
p_ni: 0.000115728
Score: 0.858
Data Source: BioPlex,STRINGDB
FGB
Tbio
Novelty: 0.00757235
p_int: 0.99428714
p_ni: 0.002169498
p_wrong: 0.003543362
Data Source: BioPlex
SPANXN4
Tdark
Novelty: 8
p_int: 0.990593246
p_ni: 0.000558181
p_wrong: 0.008848573
Data Source: BioPlex
C2orf73
Tdark
p_int: 0.990233015
p_ni: 0.005668426
p_wrong: 0.00409856
Data Source: BioPlex
GNAQ
Tbio
Novelty: 0.00176666
p_int: 0.984858431
p_ni: 0.015141543
p_wrong: 2.6e-8
Score: 0.151
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  91.80

PubMed score by year
PubTator Score  55.38

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTG
1-70
KQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS
70-140
ALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYY
140-210
QTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEG
210-280
GGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM
280-314
MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM