You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DIAPH3
Protein diaphanous homolog 3

Protein Summary
Description
Actin nucleation and elongation factor required for the assembly of F-actin structures, such as actin cables and stress fibers. Required for cytokinesis, stress fiber formation and transcriptional activation of the serum response factor. Binds to GTP-bound form of Rho and to profilin: acts in a Rho-dependent manner to recruit profilin to the membrane, where it promotes actin polymerization. DFR proteins couple Rho and Src tyrosine kinase during signaling and the regulation of actin dynamics. Also acts as an actin nucleation and elongation factor in the nucleus by promoting nuclear actin polymerization inside the nucleus to drive serum-dependent SRF-MRTFA activity. This gene encodes a member of the diaphanous subfamily of the formin family. Members of this family are involved in actin remodeling and regulate cell movement and adhesion. Mutations in this gene are associated with autosomal dominant auditory neuropathy 1. Multiple transcript variants encoding different isoforms have been f ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000267215
  • ENSP00000267215
  • ENSG00000139734
  • ENST00000377908
  • ENSP00000367141
  • ENST00000400319
  • ENSP00000383173
  • ENST00000400320
  • ENSP00000383174
  • ENST00000400324
  • ENSP00000383178
  • ENST00000465066
  • ENSP00000478137
  • ENST00000498416
  • ENSP00000479091

Symbol
  • DIAP3
  • AN
  • DIA2
  • DRF3
  • AUNA1
  • NSDAN
  • diap3
  • mDia2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.99
protein domain
0.97
trait
0.93
hub protein
0.92
transcription factor binding site profile
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 65.74   (req: < 5)
Gene RIFs: 20   (req: <= 3)
Antibodies: 239   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 65.74   (req: >= 5)
Gene RIFs: 20   (req: > 3)
Antibodies: 239   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (21)
RHO GTPase Effectors (R-HSA-195258)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
RHO GTPase Effectors
Reactome
RHO GTPases Activate Formins
Reactome
Signal Transduction
Reactome
Signaling by Rho GTPases
Name
Explore in Pharos
Explore in Source
RHO GTPase Effectors
RHO GTPases Activate Formins
Signal Transduction
Signaling by Rho GTPases
Gene Ontology Terms (10)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
BHF-UCL
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (157)
1 – 10 of 157
S100A4
Tbio
Novelty: 0.00156469
p_int: 0.999999487
p_ni: 5.13e-7
Data Source: BioPlex
ENPP6
Tbio
Family: Enzyme
Novelty: 0.104096
p_int: 0.99999516
p_ni: 0.000004837
p_wrong: 3e-9
Data Source: BioPlex
EPHA1
Tchem
Family: Kinase
Novelty: 0.00080325
p_int: 0.99997974
p_ni: 0.00002026
Score: 0.159
Data Source: BioPlex,STRINGDB
TPTE2
Tbio
Family: Enzyme
Novelty: 0.04938272
p_int: 0.999939315
p_ni: 0.000060685
Data Source: BioPlex
CCDC183
Tdark
p_int: 0.997992365
p_ni: 0.002007635
Data Source: BioPlex
PNKD
Tbio
Family: Enzyme
Novelty: 0.01082297
p_int: 0.995753342
p_ni: 0.004246658
p_wrong: 1e-9
Data Source: BioPlex
BCHE
Tclin
Family: Enzyme
Novelty: 0.00041933
p_int: 0.995353887
p_ni: 0.004646107
p_wrong: 6e-9
Score: 0.179
Data Source: BioPlex,STRINGDB
VASN
Tbio
Novelty: 0.04337164
p_int: 0.990878813
p_ni: 0.009121187
Data Source: BioPlex
TMEM126A
Tbio
Novelty: 0.08207934
p_int: 0.979898971
p_ni: 0.02010045
p_wrong: 5.79e-7
Score: 0.682
Data Source: BioPlex,STRINGDB
HS2ST1
Tbio
Family: Enzyme
Novelty: 0.06029259
p_int: 0.962355878
p_ni: 0.037644122
Score: 0.163
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  65.74

PubMed score by year
PubTator Score  22.81

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MERHQPRLHHPAQGSAAGTPYPSSASLRGCRESKMPRRKGPQHPPPPSGPEEPGEKRPKFHLNIRTLTDD
1-70
MLDKFASIRIPGSKKERPPLPNLKTAFASSDCSAAPLEMMENFPKPLSENELLELFEKMMEDMNLNEDKK
70-140
APLREKDFSIKKEMVMQYINTASKTGSLKRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPVSW
140-210
VESFGHEGLGLLLDILEKLISGKIQEKVVKKNQHKVIQCLKALMNTQYGLERIMSEERSLSLLAKAVDPR
210-280
HPNMMTDVVKLLSAVCIVGEESILEEVLEALTSAGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVT
280-350
SPDDLDFRLHIRNEFMRCGLKEILPNLKCIKNDGLDIQLKVFDEHKEEDLFELSHRLEDIRAELDEAYDV
350-420
YNMVWSTVKETRAEGYFISILQHLLLIRNDYFIRQQYFKLIDECVSQIVLHRDGMDPDFTYRKRLDLDLT
420-490
QFVDICIDQAKLEEFEEKASELYKKFEKEFTDHQETQAELQKKEAKINELQAELQAFKSQFGALPADCNI
490-560
PLPPSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLPGMRMPFSGPVPPPPPLGFLGGQNSPPLPIL
560-630
PFGLKPKKEFKPEISMRRLNWLKIRPHEMTENCFWIKVNENKYENVDLLCKLENTFCCQQKERREEEDIE
630-700
EKKSIKKKIKELKFLDSKIAQNLSIFLSSFRVPYEEIRMMILEVDETRLAESMIQNLIKHLPDQEQLNSL
700-770
SQFKSEYSNLCEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFSKLL
770-840
ELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNFVDDLEPLDKA
840-910
SKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQS
910-980
IIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLL
980-1050
EMKTEGDETGVMDNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHENQKVQLTEGSRSH
1050-1120
YNINCNSTRTPVAKELNYNLDTHTSTGRIKAAEKKEACNVESNRKKETELLGSFSKNESVPEVEALLARL
1120-1190
RAL
1190-1193
MERHQPRLHHPAQGSAAGTPYPSSASLRGCRESKMPRRKGPQHPPPPSGPEEPGEKRPKFHLNIRTLTDDMLDKFASIRIPGSKKERPPLPNLKTAFASSDCSAAPLEMMENFPKPLSENELLELFEKMMEDMNLNEDKKAPLREKDFSIKKEMVMQYINTASKTGSLKRSRQISPQEFIHELKMGSADERLVTCLESLRVSLTSNPVSWVESFGHEGLGLLLDILEKLISGKIQEKVVKKNQHKVIQCLKALMNTQYGLERIMSEERSLSLLAKAVDPRHPNMMTDVVKLLSAVCIVGEESILEEVLEALTSAGEEKKIDRFFCIVEGLRHNSVQLQVACMQLINALVTSPDDLDFRLHIRNEFMRCGLKEILPNLKCIKNDGLDIQLKVFDEHKEEDLFELSHRLEDIRAELDEAYDVYNMVWSTVKETRAEGYFISILQHLLLIRNDYFIRQQYFKLIDECVSQIVLHRDGMDPDFTYRKRLDLDLTQFVDICIDQAKLEEFEEKASELYKKFEKEFTDHQETQAELQKKEAKINELQAELQAFKSQFGALPADCNIPLPPSKEGGTGHSALPPPPPLPSGGGVPPPPPPPPPPPLPGMRMPFSGPVPPPPPLGFLGGQNSPPLPILPFGLKPKKEFKPEISMRRLNWLKIRPHEMTENCFWIKVNENKYENVDLLCKLENTFCCQQKERREEEDIEEKKSIKKKIKELKFLDSKIAQNLSIFLSSFRVPYEEIRMMILEVDETRLAESMIQNLIKHLPDQEQLNSLSQFKSEYSNLCEPEQFVVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFSKLLELVLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLLEMKTEGDETGVMDNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHENQKVQLTEGSRSHYNINCNSTRTPVAKELNYNLDTHTSTGRIKAAEKKEACNVESNRKKETELLGSFSKNESVPEVEALLARLRAL