You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CHST7
Carbohydrate sulfotransferase 7

Protein Summary
Description
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues. Preferentially acts on mannose-linked GlcNAc. Also able to catalyze the transfer of sulfate to position 6 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Also acts on core 2 mucin-type oligosaccharide and N-acetyllactosamine oligomer with a lower efficiency. Has weak or no activity toward keratan sulfate and oligosaccharides containing the Galbeta1-4GlcNAc. Catalyzes 6-O-sulfation of beta-benzyl GlcNAc but not alpha- or beta-benzyl GalNAc. This gene is a member of the Gal/GalNAc/GlcNAc (galactose/N-acetylgalactosamine/N-acetylglucosamine) 6-O-sulfotransferase (GST) family. Members of this family encode enzymes that catalyze the specific addition of sulfate groups to distinct hydroxyl and amino groups of carbohydrates. The encoded protein catalyzes the sulfation of 6-hydroxyl group o ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000276055
  • ENSP00000276055
  • ENSG00000147119

Symbol
  • GST-5
  • C6ST-2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.68
tissue sample
0.66
cell type or tissue
0.6
pathway
0.58
gene perturbation
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.65   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 40   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.65   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 40   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Chondroitin sulfate biosynthesis (R-HSA-2022870)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Chondroitin sulfate biosynthesis
Reactome
Chondroitin sulfate/dermatan sulfate metabolism
Reactome
Glycosaminoglycan metabolism
Reactome
Metabolism
Reactome
Metabolism of carbohydrates
Name
Explore in Pharos
Explore in Source
Chondroitin sulfate biosynthesis
Chondroitin sulfate/dermatan sulfate metabolism
Glycosaminoglycan metabolism
Metabolism
Metabolism of carbohydrates
Protein-Protein Interactions (55)
1 – 10 of 55
LCN6
Tbio
Novelty: 0.06664903
p_int: 0.989186788
p_ni: 0.006325047
p_wrong: 0.004488165
Data Source: BioPlex
PEX19
Tbio
Novelty: 0.00469515
p_int: 0.971017789
p_ni: 0.007046369
p_wrong: 0.021935842
Score: 0.187
Data Source: BioPlex,STRINGDB
HFE
Tbio
Novelty: 0.00040976
p_int: 0.949899653
p_ni: 0.03631363
p_wrong: 0.013786717
Data Source: BioPlex
CHST12
Tbio
Family: Enzyme
Novelty: 0.07210463
Score: 0.983
Data Source: STRINGDB
UST
Tbio
Family: Enzyme
Novelty: 0.00328192
Score: 0.977
Data Source: STRINGDB
CHST13
Tbio
Family: Enzyme
Novelty: 0.2520252
Score: 0.972
Data Source: STRINGDB
CHST11
Tbio
Family: Enzyme
Novelty: 0.03190916
Score: 0.961
Data Source: STRINGDB
VCAN
Tbio
Novelty: 0.00132314
Score: 0.923
Data Source: STRINGDB
DCN
Tbio
Novelty: 0.00087842
Score: 0.913
Data Source: STRINGDB
BGN
Tbio
Novelty: 0.00181025
Score: 0.911
Data Source: STRINGDB
Publication Statistics
PubMed Score  4.65

PubMed score by year
PubTator Score  5.87

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKGRRRRRREYCKFALLLVLYTLVLLLVPSVLDGGRDGDKGAEHCPGLQRSLGVWSLEAAAAGEREQGAE
1-70
ARAAEEGGANQSPRFPSNLSGAVGEAVSREKQHIYVHATWRTGSSFLGELFNQHPDVFYLYEPMWHLWQA
70-140
LYPGDAESLQGALRDMLRSLFRCDFSVLRLYAPPGDPAARAPDTANLTTAALFRWRTNKVICSPPLCPGA
140-210
PRARAEVGLVEDTACERSCPPVAIRALEAECRKYPVVVIKDVRLLDLGVLVPLLRDPGLNLKVVQLFRDP
210-280
RAVHNSRLKSRQGLLRESIQVLRTRQRGDRFHRVLLAHGVGARPGGQSRALPAAPRADFFLTGALEVICE
280-350
AWLRDLLFARGAPAWLRRRYLRLRYEDLVRQPRAQLRRLLRFSGLRALAALDAFALNMTRGAAYGADRPF
350-420
HLSARDAREAVHAWRERLSREQVRQVEAACAPAMRLLAYPRSGEEGDAEQPREGETPLEMDADGAT
420-486
MKGRRRRRREYCKFALLLVLYTLVLLLVPSVLDGGRDGDKGAEHCPGLQRSLGVWSLEAAAAGEREQGAEARAAEEGGANQSPRFPSNLSGAVGEAVSREKQHIYVHATWRTGSSFLGELFNQHPDVFYLYEPMWHLWQALYPGDAESLQGALRDMLRSLFRCDFSVLRLYAPPGDPAARAPDTANLTTAALFRWRTNKVICSPPLCPGAPRARAEVGLVEDTACERSCPPVAIRALEAECRKYPVVVIKDVRLLDLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTRQRGDRFHRVLLAHGVGARPGGQSRALPAAPRADFFLTGALEVICEAWLRDLLFARGAPAWLRRRYLRLRYEDLVRQPRAQLRRLLRFSGLRALAALDAFALNMTRGAAYGADRPFHLSARDAREAVHAWRERLSREQVRQVEAACAPAMRLLAYPRSGEEGDAEQPREGETPLEMDADGAT