You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PLSCR3
Phospholipid scramblase 3

Protein Summary
Description
May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. Seems to play a role in apoptosis, through translocation of cardiolipin from the inner to the outer mitochondrial membrane which promotes BID recruitment and enhances tBid-induced mitochondrial damages.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000324822
  • ENSP00000316021
  • ENSG00000187838
  • ENST00000535512
  • ENSP00000438547
  • ENST00000574401
  • ENSP00000459019
  • ENST00000576201
  • ENSP00000459419
  • ENST00000639780
  • ENSP00000492083
  • ENSG00000284009
  • ENST00000640053
  • ENSP00000491350
  • ENST00000640375
  • ENSP00000491393
  • ENST00000640848
  • ENSP00000492348
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
metabolite
0.98
kinase perturbation
0.91
transcription factor perturbation
0.88
tissue sample
0.73
transcription factor
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.05   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 149   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.05   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 149   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (33)
1 – 10 of 33
PRKCD
Tclin
Family: Kinase
Novelty: 0.00129351
Score: 0.674
Data Source: STRINGDB
PLS3
Tbio
Novelty: 0.01113879
Score: 0.654
Data Source: STRINGDB
PDCD6
Tbio
Novelty: 0.01593709
Score: 0.637
Data Source: STRINGDB
ATP8A2
Tbio
Family: Transporter
Novelty: 0.04768962
Score: 0.623
Data Source: STRINGDB
MUC4
Tbio
Novelty: 0.00238494
Score: 0.622
Data Source: STRINGDB
ANO6
Tbio
Family: IC
Novelty: 0.01570866
Score: 0.617
Data Source: STRINGDB
CHERP
Tbio
Novelty: 0.15306122
Score: 0.559
Data Source: STRINGDB
XKR8
Tbio
Novelty: 0.1242236
Score: 0.556
Data Source: STRINGDB
SHISA4
Tdark
Score: 0.555
Data Source: STRINGDB
SHISA5
Tbio
Novelty: 0.33341753
Score: 0.515
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.05

PubMed score by year
PubTator Score  13.82

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLP
1-70
GVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVR
70-140
LADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGP
140-210
CWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYM
210-280
FFEKRGGAGPSAVTS
280-295
MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYMFFEKRGGAGPSAVTS