You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ABCB10
ATP-binding cassette sub-family B member 10, mitochondrial

Protein Classes
Protein Summary
Description
May mediate critical mitochondrial transport functions related to heme biosynthesis. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000344517
  • ENSP00000355637
  • ENSG00000135776

Symbol
  • M-ABC2
  • MTABC2
  • EST20237
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
molecular function
0.99
protein domain
0.85
virus perturbation
0.85
transcription factor binding site profile
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 162.2   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 206   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 162.2   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 206   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
ABC-family proteins mediated transport (R-HSA-382556)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
ABC-family proteins mediated transport
Reactome
Mitochondrial ABC transporters
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
ABC-family proteins mediated transport
Mitochondrial ABC transporters
Transport of small molecules
Protein-Protein Interactions (61)
1 – 10 of 61
CEACAM21
Tdark
Novelty: 0.98765432
p_int: 0.999996175
p_ni: 0.000003825
Data Source: BioPlex
TRDN
Tbio
Novelty: 0.00251509
p_int: 0.999478502
p_ni: 0.000521498
Data Source: BioPlex
EIF2B5
Tbio
Novelty: 0.01114599
p_int: 0.999385318
p_ni: 0.000614682
Data Source: BioPlex
IMPDH1
Tclin
Family: Enzyme
Novelty: 0.01078039
p_int: 0.999325248
p_ni: 0.000674752
Score: 0.158
Data Source: BioPlex,STRINGDB
CTAGE5
Tbio
Novelty: 0.06289332
p_int: 0.999263312
p_ni: 0.000736688
Data Source: BioPlex
DKK3
Tbio
Novelty: 0.00427648
p_int: 0.999222171
p_ni: 0.000777829
Score: 0.163
Data Source: BioPlex,STRINGDB
SGSM1
Tbio
Novelty: 0.55684455
p_int: 0.991801764
p_ni: 0.008198236
Data Source: BioPlex
SLC24A5
Tbio
Family: Transporter
Novelty: 0.01966176
p_int: 0.989736473
p_ni: 0.010263526
p_wrong: 1e-9
Score: 0.214
Data Source: BioPlex,STRINGDB
SLC39A4
Tbio
Family: Transporter
Novelty: 0.00826526
p_int: 0.987788672
p_ni: 0.012211328
Data Source: BioPlex
SNX4
Tbio
Novelty: 0.07239775
p_int: 0.984496356
p_ni: 0.015503644
Score: 0.261
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  162.20

PubMed score by year
PubTator Score  15.45

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRGPPAWPLRLLEPPSPAEPGRLLPVACVWAAASRVPGSLSPFTGLRPARLWGAGPALLWGVGAARRWRS
1-70
GCRGGGPGASRGVLGLARLLGLWARGPGSCRCGAFAGPGAPRLPRARFPGGPAAAAWAGDEAWRRGPAAP
70-140
PGDKGRLRPAAAGLPEARKLLGLAYPERRRLAAAVGFLTMSSVISMSAPFFLGKIIDVIYTNPTVDYSDN
140-210
LTRLCLGLSAVFLCGAAANAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTA
210-280
LLGRSVTENLSDGLRAGAQASVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQA
280-350
TQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLL
350-420
MGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRLWELLEREPKLPFNEGVILNEKSFQG
420-490
ALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPASGTISLDGHDIRQ
490-560
LNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEK
560-630
GVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANM
630-700
VAVLDQGKITEYGKHEELLSKPNGIYRKLMNKQSFISA
700-738
MRGPPAWPLRLLEPPSPAEPGRLLPVACVWAAASRVPGSLSPFTGLRPARLWGAGPALLWGVGAARRWRSGCRGGGPGASRGVLGLARLLGLWARGPGSCRCGAFAGPGAPRLPRARFPGGPAAAAWAGDEAWRRGPAAPPGDKGRLRPAAAGLPEARKLLGLAYPERRRLAAAVGFLTMSSVISMSAPFFLGKIIDVIYTNPTVDYSDNLTRLCLGLSAVFLCGAAANAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRSVTENLSDGLRAGAQASVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQATQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLLMGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRLWELLEREPKLPFNEGVILNEKSFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLDQGKITEYGKHEELLSKPNGIYRKLMNKQSFISA