You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CCL28
C-C motif chemokine 28

Protein Summary
Description
Chemotactic activity for resting CD4, CD8 T-cells and eosinophils. Binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner. This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for resting CD4 or CD8 T cells and eosinophils. The product of this gene binds to chemokine receptors CCR3 and CCR10. This chemokine may play a role in the physiology of extracutaneous epithelial tissues, including diverse mucosal organs. Multiple transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000361115
  • ENSP00000354416
  • ENSG00000151882
  • ENST00000489442
  • ENSP00000426424

Symbol
  • SCYA28
  • MEC
  • CCK1
  • SCYA28
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.64
gene perturbation
0.59
biological process
0.56
PubMedID
0.5
metabolite
0.45


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 138.14   (req: < 5)
Gene RIFs: 23   (req: <= 3)
Antibodies: 309   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 138.14   (req: >= 5)
Gene RIFs: 23   (req: > 3)
Antibodies: 309   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (127)
Chemokine receptors bind chemokines (R-HSA-380108)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Chemokine receptors bind chemokines
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Chemokine receptors bind chemokines
Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Gene Ontology Terms (16)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (243)
1 – 10 of 243
CCR10
Tchem
Family: GPCR
Novelty: 0.02210897
Score: 0.975
Data Source: Reactome,STRINGDB
CCR9
Tchem
Family: GPCR
Novelty: 0.00938624
Score: 0.963
Data Source: STRINGDB
CXCR5
Tbio
Family: GPCR
Novelty: 0.00344277
Score: 0.959
Data Source: STRINGDB
PYY
Tbio
Novelty: 0.0007798
Score: 0.953
Data Source: STRINGDB
CCR3
Tchem
Family: GPCR
Novelty: 0.00249792
Score: 0.951
Data Source: STRINGDB
NPY
Tbio
Novelty: 0.00014761
Score: 0.947
Data Source: STRINGDB
CCL25
Tbio
Novelty: 0.01203102
Score: 0.941
Data Source: STRINGDB
CNR1
Tclin
Family: GPCR
Novelty: 0.00017618
Score: 0.94
Data Source: STRINGDB
CXCL13
Tbio
Novelty: 0.00156696
Score: 0.939
Data Source: STRINGDB
CCK
Tbio
Novelty: 0.00013779
Score: 0.938
Data Source: STRINGDB
Publication Statistics
PubMed Score  138.14

PubMed score by year
PubTator Score  400.81

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRR
1-70
RICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
70-127
MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY