You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DISC1
Disrupted in schizophrenia 1 protein

Protein Summary
Description
Involved in the regulation of multiple aspects of embryonic and adult neurogenesis. Required for neural progenitor proliferation in the ventrical/subventrical zone during embryonic brain development and in the adult dentate gyrus of the hippocampus. Participates in the Wnt-mediated neural progenitor proliferation as a positive regulator by modulating GSK3B activity and CTNNB1 abundance. Plays a role as a modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of newborn neurons integration during adult neurogenesis, including neuron positioning, dendritic development and synapse formation. Inhibits the activation of AKT-mTOR signaling upon interaction with CCDC88A. Regulates the migration of early-born granule cell precursors toward the dentate gyrus during the hippocampal development. Plays a role, together with PCNT, in the microtubule network formation. This gene encodes a protein with multiple coiled coil motifs which is located in the nucleus, cytoplasm an ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000317586
  • ENSP00000320784
  • ENSG00000162946
  • ENST00000366633
  • ENSP00000355593
  • ENST00000366636
  • ENSP00000355596
  • ENST00000366637
  • ENSP00000355597
  • ENST00000439617
  • ENSP00000403888
  • ENST00000535983
  • ENSP00000443996
  • ENST00000539444
  • ENSP00000440953
  • ENST00000602281
  • ENSP00000473425
  • ENST00000602700
  • ENSP00000473417
  • ENST00000602713
  • ENSP00000473261
  • ENST00000602822
  • ENSP00000473586
  • ENST00000602873
  • ENSP00000473386
  • ENST00000628350
  • ENSP00000487190
  • ENST00000639374
  • ENSP00000491762

Symbol
  • KIAA0457
  • SCZD9
  • C1orf136
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
0.97
cellular component
0.86
biological process
0.84
histone modification site profile
0.77
phenotype
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 616.49   (req: < 5)
Gene RIFs: 217   (req: <= 3)
Antibodies: 586   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 616.49   (req: >= 5)
Gene RIFs: 217   (req: > 3)
Antibodies: 586   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (15)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
SYSCILIA_CCNET
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
MGI
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (185)
1 – 10 of 185
GRIPAP1
Tbio
Novelty: 0.16116654
p_int: 0.999999961
p_ni: 4e-8
Score: 0.177
Data Source: BioPlex,STRINGDB
AP4E1
Tdark
Novelty: 0.2006689
p_int: 0.999999956
p_ni: 4.3e-8
p_wrong: 1e-9
Data Source: BioPlex
AP4B1
Tbio
Novelty: 0.1488148
p_int: 0.999999786
p_ni: 2.14e-7
Data Source: BioPlex
AP4M1
Tbio
Novelty: 0.0041214
p_int: 0.999999441
p_ni: 5.59e-7
Data Source: BioPlex
NDEL1
Tbio
Novelty: 0.01425912
p_int: 0.999999283
p_ni: 7.17e-7
Score: 0.934
Data Source: BioPlex,STRINGDB
OFD1
Tbio
Novelty: 0.01254464
p_int: 0.999998006
p_ni: 0.000001994
Data Source: BioPlex
MCM10
Tbio
Novelty: 0.01797946
p_int: 0.999981355
p_ni: 0.000018645
Data Source: BioPlex
BRK1
Tbio
Novelty: 0.03479369
p_int: 0.999965062
p_ni: 0.000034938
Data Source: BioPlex
RNF20
Tbio
Family: Enzyme
Novelty: 0.0151325
p_int: 0.999955814
p_ni: 0.000044185
p_wrong: 1e-9
Data Source: BioPlex
NDE1
Tbio
Novelty: 0.01199577
p_int: 0.999955134
p_ni: 0.000044866
Score: 0.733
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  616.49

PubMed score by year
PubTator Score  386.99

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGG
1-70
VSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGIQLRGGTRLPDRLSWPCGPGS
70-140
AGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSAELSSNSCSPGCGPEVPPTPPGSHSAFTSSF
140-210
SFIRLSLGSAGERGEAEGCPPSREAESHCQSPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQA
210-280
ARNSSRPERDMHSLPDMDPGSSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEV
280-350
ISLRLKLQKLQEDAVENDDYDKAETLQQRLEDLEQEKISLHFQLPSRQPALSSFLGHLAAQVQAALRRGA
350-420
TQQASGDDTHTPLRMEPRLLEPTAQDSLHVSITRRDWLLQEKQQLQKEIEALQARMFVLEAKDQQLRREI
420-490
EEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPPETIRSLQERIKSLNLSLKEI
490-560
TTKVCMSEKFCSTLRKKVNDIETQLPALLEAKMHAISGNHFWTAKDLTEEIRSLTSEREGLEGLLSKLLV
560-630
LSSRNVKKLGSVKEDYNRLRREVEHQETAYETSVKENTMKYMETLKNKLCSCKCPLLGKVWEADLEACRL
630-700
LIQSLQLQEARGSLSVEDERQMDDLEGAAPPIPPRLHSEDKRKTPLKVLEEWKTHLIPSLHCAGGEQKEE
700-770
SYILSAELGEKCEDIGKKLLYLEDQLHTAIHSHDEDLIQSLRRELQMVKETLQAMILQLQPAKEAGEREA
770-840
AASCMTAGVHEAQA
840-854
MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGGVSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGIQLRGGTRLPDRLSWPCGPGSAGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSAELSSNSCSPGCGPEVPPTPPGSHSAFTSSFSFIRLSLGSAGERGEAEGCPPSREAESHCQSPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQAARNSSRPERDMHSLPDMDPGSSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEVISLRLKLQKLQEDAVENDDYDKAETLQQRLEDLEQEKISLHFQLPSRQPALSSFLGHLAAQVQAALRRGATQQASGDDTHTPLRMEPRLLEPTAQDSLHVSITRRDWLLQEKQQLQKEIEALQARMFVLEAKDQQLRREIEEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPPETIRSLQERIKSLNLSLKEITTKVCMSEKFCSTLRKKVNDIETQLPALLEAKMHAISGNHFWTAKDLTEEIRSLTSEREGLEGLLSKLLVLSSRNVKKLGSVKEDYNRLRREVEHQETAYETSVKENTMKYMETLKNKLCSCKCPLLGKVWEADLEACRLLIQSLQLQEARGSLSVEDERQMDDLEGAAPPIPPRLHSEDKRKTPLKVLEEWKTHLIPSLHCAGGEQKEESYILSAELGEKCEDIGKKLLYLEDQLHTAIHSHDEDLIQSLRRELQMVKETLQAMILQLQPAKEAGEREAAASCMTAGVHEAQA