You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TUBG2
Tubulin gamma-2 chain

Protein Summary
Description
Tubulin is the major constituent of microtubules. The gamma chain is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome. Pericentriolar matrix component that regulates alpha/beta chain minus-end nucleation, centrosome duplication and spindle formation (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000251412
  • ENSP00000251412
  • ENSG00000037042
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.92
molecular function
0.91
histone modification site profile
0.66
interacting protein
0.66
protein complex
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.37   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 66   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.37   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 66   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (10)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Cell Cycle, Mitotic
Reactome
Centrosome maturation
Reactome
G2/M Transition
Reactome
M Phase
Name
Explore in Pharos
Explore in Source
Cell Cycle
Cell Cycle, Mitotic
Centrosome maturation
G2/M Transition
M Phase
Protein-Protein Interactions (119)
1 – 10 of 119
TUBGCP5
Tbio
Novelty: 0.12782794
p_int: 1
Score: 0.989
Data Source: BioPlex,STRINGDB
MZT2A
Tdark
Novelty: 4
p_int: 0.99999982
p_ni: 7.9e-8
p_wrong: 1.01e-7
Score: 0.978
Data Source: BioPlex,STRINGDB
TUBGCP4
Tbio
Novelty: 0.01120518
p_int: 0.999992732
p_ni: 0.000007261
p_wrong: 7e-9
Score: 0.983
Data Source: BioPlex,STRINGDB
TUBGCP6
Tbio
Novelty: 0.14014014
p_int: 0.999991044
p_ni: 0.000008952
p_wrong: 4e-9
Score: 0.996
Data Source: BioPlex,STRINGDB
TUBG1
Tbio
Novelty: 0.03880643
p_int: 0.99998397
p_ni: 0.00001603
Score: 0.97
Data Source: BioPlex,Reactome,STRINGDB
TUBGCP3
Tbio
Novelty: 0.0308076
p_int: 0.999859712
p_ni: 0.000140288
Score: 0.997
Data Source: BioPlex,Reactome,STRINGDB
MZT2B
Tdark
Novelty: 4
p_int: 0.999741843
p_ni: 0.000258154
p_wrong: 2e-9
Score: 0.981
Data Source: BioPlex,STRINGDB
TUBGCP2
Tbio
Novelty: 0.03216604
p_int: 0.997566344
p_ni: 0.002433656
Score: 0.996
Data Source: BioPlex,Reactome,STRINGDB
NME7
Tbio
Family: Enzyme
Novelty: 0.11051019
p_int: 0.994137613
p_ni: 0.005862387
Score: 0.956
Data Source: BioPlex,STRINGDB
CCT3
Tbio
Novelty: 0.00555442
p_int: 0.963579483
p_ni: 0.036420517
Score: 0.551
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  4.37

PubMed score by year
PubTator Score  2.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLE
1-70
PRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHS
70-140
IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTAL
140-210
NRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ
210-280
SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIP
280-350
WGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDE
350-420
MDRSREVVQELIDEYHAATQPDYISWGTQEQ
420-451
MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYISWGTQEQ