You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MMP26
Matrix metalloproteinase-26

Protein Summary
Description
May hydrolyze collagen type IV, fibronectin, fibrinogen, beta-casein, type I gelatin and alpha-1 proteinase inhibitor. Is also able to activate progelatinase B. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme may degrade collagen type IV, fibronectin, fibrinogen, and beta-casein, and activate matrix metalloproteinase-9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The encoded protein may promote cell invasion in multiple human cancers. [provided by RefSeq, May 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000300762
  • ENSP00000300762
  • ENSG00000167346
  • ENST00000380390
  • ENSP00000369753
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.73
tissue
0.72
phenotype
0.62
cell type or tissue
0.58
biological term
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 53.3   (req: < 5)
Gene RIFs: 40   (req: <= 3)
Antibodies: 179   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 53.3   (req: >= 5)
Gene RIFs: 40   (req: > 3)
Antibodies: 179   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 8
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (10)
Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Matrix Metalloproteinases
WikiPathways
Matrix Metalloproteinases
WikiPathways
Matrix Metalloproteinases
WikiPathways
Matrix Metalloproteinases
WikiPathways
Matrix Metalloproteinases
Name
Explore in Pharos
Explore in Source
Matrix Metalloproteinases
Matrix Metalloproteinases
Matrix Metalloproteinases
Matrix Metalloproteinases
Matrix Metalloproteinases
Gene Ontology Terms (6)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (26)
1 – 10 of 26
FECH
Tbio
Family: Enzyme
Novelty: 0.00199177
p_int: 0.999931943
p_ni: 0.000068057
Score: 0.156
Data Source: BioPlex,STRINGDB
SLC25A20
Tbio
Family: Transporter
Novelty: 0.00531784
p_int: 0.999103976
p_ni: 0.000895447
p_wrong: 5.77e-7
Score: 0.165
Data Source: BioPlex,STRINGDB
PPP1R10
Tbio
Family: Enzyme
Novelty: 0.01806867
p_int: 0.994670196
p_ni: 0.005294321
p_wrong: 0.000035483
Score: 0.173
Data Source: BioPlex,STRINGDB
CNTNAP3B
Tdark
Novelty: 0.3692932
p_int: 0.98848364
p_ni: 0.011516358
p_wrong: 1e-9
Score: 0.186
Data Source: BioPlex,STRINGDB
EFR3A
Tdark
Novelty: 0.21815349
p_int: 0.96697463
p_ni: 0.033024097
p_wrong: 0.000001273
Data Source: BioPlex
GNB2
Tbio
Novelty: 0.20536996
p_int: 0.935974494
p_ni: 0.064025429
p_wrong: 7.7e-8
Data Source: BioPlex
PTPRK
Tbio
Family: Enzyme
Novelty: 0.03472453
p_int: 0.918425016
p_ni: 0.081574979
p_wrong: 5e-9
Data Source: BioPlex
ZNF146
Tbio
Family: TF
Novelty: 0.06892025
p_int: 0.897324287
p_ni: 0.102657363
p_wrong: 0.00001835
Score: 0.173
Data Source: BioPlex,STRINGDB
PDF
Tchem
Family: Enzyme
Novelty: 0.02731986
p_int: 0.86696287
p_ni: 0.13303713
Data Source: BioPlex
ADGRL3
Tbio
Family: GPCR
Novelty: 0.00182297
p_int: 0.837525416
p_ni: 0.00170654
p_wrong: 0.160768044
Score: 0.19
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  53.30

PubMed score by year
PubTator Score  61.69

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLD
1-70
MQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQ
70-140
QVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEI
140-210
GHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP
210-261
MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP