You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ARHGEF3
Rho guanine nucleotide exchange factor 3

Protein Summary
Description
Acts as guanine nucleotide exchange factor (GEF) for RhoA and RhoB GTPases. Rho-like GTPases are involved in a variety of cellular processes, and they are activated by binding GTP and inactivated by conversion of GTP to GDP by their intrinsic GTPase activity. Guanine nucleotide exchange factors (GEFs) accelerate the GTPase activity of Rho GTPases by catalyzing their release of bound GDP. This gene encodes a guanine nucleotide exchange factor, which specifically activates two members of the Rho GTPase family: RHOA and RHOB, both of which have a role in bone cell biology. It has been identified that genetic variation in this gene plays a role in the determination of bone mineral density (BMD), indicating the implication of this gene in postmenopausal osteoporosis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000296315
  • ENSP00000296315
  • ENSG00000163947
  • ENST00000338458
  • ENSP00000341071
  • ENST00000413728
  • ENSP00000410922

Symbol
  • GEF3
  • STA3
  • XPLN
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.91
gene perturbation
0.9
transcription factor perturbation
0.8
histone modification site profile
0.76
phenotype
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 21.47   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 165   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 21.47   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 165   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (11)
Cell death signalling via NRAGE, NRIF and NADE (R-HSA-204998)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell death signalling via NRAGE, NRIF and NADE
Reactome
Death Receptor Signalling
Reactome
G alpha (12/13) signalling events
Reactome
GPCR downstream signalling
Reactome
NRAGE signals death through JNK
Name
Explore in Pharos
Explore in Source
Cell death signalling via NRAGE, NRIF and NADE
Death Receptor Signalling
G alpha (12/13) signalling events
GPCR downstream signalling
NRAGE signals death through JNK
Protein-Protein Interactions (54)
1 – 10 of 54
RHOA
Tbio
Family: Enzyme
Novelty: 0.0002729
Score: 0.989
Data Source: STRINGDB
RHOB
Tbio
Family: Enzyme
Novelty: 0.0034061
Score: 0.982
Data Source: STRINGDB
RHOC
Tbio
Family: Enzyme
Novelty: 0.00407673
Score: 0.974
Data Source: STRINGDB
CDC42
Tchem
Family: Enzyme
Novelty: 0.00039759
Score: 0.967
Data Source: STRINGDB
RHOG
Tbio
Family: Enzyme
Novelty: 0.0076798
Score: 0.96
Data Source: STRINGDB
RAC2
Tbio
Family: Enzyme
Novelty: 0.00123743
Score: 0.94
Data Source: STRINGDB
RAC1
Tbio
Family: Enzyme
Novelty: 0.00579565
Score: 0.939
Data Source: STRINGDB
RHOU
Tbio
Family: Enzyme
Novelty: 0.02652323
Score: 0.938
Data Source: STRINGDB
RAC3
Tbio
Family: Enzyme
Novelty: 0.05044614
Score: 0.938
Data Source: STRINGDB
RHOF
Tbio
Family: Enzyme
Novelty: 0.02666805
Score: 0.935
Data Source: STRINGDB
Publication Statistics
PubMed Score  21.47

PubMed score by year
PubTator Score  17.25

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVAKDYPFYLTVKRANCSLELPPASGPAKDAEEPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQRS
1-70
ISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIED
70-140
LKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEELLSQLRDVRKPDGSTEHVGPILVGWLPCLSS
140-210
YDSYCSNQVAAKALLDHKKQDHRVQDFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPND
210-280
NPDQQHLEEAINIIQGIVAEINTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKLH
280-350
VFLFQEVLVITRAVTHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFFRVSFKN
350-420
GSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGETKLEQMDQSD
420-490
SESDCSMDTSEVSLDCERMEQTDSSCGNSRHGESNV
490-526
MVAKDYPFYLTVKRANCSLELPPASGPAKDAEEPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIEDLKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEELLSQLRDVRKPDGSTEHVGPILVGWLPCLSSYDSYCSNQVAAKALLDHKKQDHRVQDFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPNDNPDQQHLEEAINIIQGIVAEINTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKLHVFLFQEVLVITRAVTHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFFRVSFKNGSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGETKLEQMDQSDSESDCSMDTSEVSLDCERMEQTDSSCGNSRHGESNV