You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SAR1A
GTP-binding protein SAR1a

Protein Summary
Description
Involved in transport from the endoplasmic reticulum to the Golgi apparatus (By similarity). Required to maintain SEC16A localization at discrete locations on the ER membrane perhaps by preventing its dissociation. SAR1A-GTP-dependent assembly of SEC16A on the ER membrane forms an organized scaffold defining endoplasmic reticulum exit sites (ERES).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373238
  • ENSP00000362335
  • ENSG00000079332
  • ENST00000373241
  • ENSP00000362338
  • ENST00000373242
  • ENSP00000362339
  • ENST00000431664
  • ENSP00000399698

Symbol
  • SAR1
  • SARA
  • SARA1
  • SAR1
  • Sara
  • SARA1
  • masra2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
kinase perturbation
1
transcription factor perturbation
0.96
interacting protein
0.94
virus perturbation
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16.15   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 183   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16.15   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 183   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (13)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (123)
1 – 10 of 123
SAR1B
Tbio
Family: Enzyme
Novelty: 0.00730402
p_int: 0.999999998
p_ni: 2e-9
Score: 0.896
Data Source: BioPlex,STRINGDB
SEC31A
Tbio
Novelty: 0.06064315
Score: 0.995
Data Source: STRINGDB
SEC23A
Tbio
Novelty: 0.0358158
Score: 0.994
Data Source: STRINGDB
SEC24A
Tbio
Novelty: 0.14959041
Score: 0.989
Data Source: STRINGDB
SEC24B
Tbio
Novelty: 0.01524602
Score: 0.987
Data Source: STRINGDB
SEC13
Tbio
Novelty: 0.0100577
Score: 0.987
Data Source: STRINGDB
SEC24D
Tbio
Novelty: 0.06594737
Score: 0.984
Data Source: STRINGDB
SEC24C
Tbio
Novelty: 0.09004427
Score: 0.983
Data Source: STRINGDB
CDC5L
Tbio
Family: TF
Novelty: 0.00617757
Score: 0.982
Data Source: STRINGDB
PREB
Tbio
Family: TF
Novelty: 0.00430442
Score: 0.976
Data Source: STRINGDB
Publication Statistics
PubMed Score  16.15

PubMed score by year
PubTator Score  247.1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT
1-70
FTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNKIDRTD
70-140
AISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID
140-198
MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNKIDRTDAISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID