You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PDLIM7
PDZ and LIM domain protein 7

Protein Summary
Description
May function as a scaffold on which the coordinated assembly of proteins can occur. May play a role as an adapter that, via its PDZ domain, localizes LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Involved in both of the two fundamental mechanisms of bone formation, direct bone formation (e.g. embryonic flat bones mandible and cranium), and endochondral bone formation (e.g. embryonic long bone development). Plays a role during fracture repair. Involved in BMP6 signaling pathway (By similarity). The protein encoded by this gene is representative of a family of proteins composed of conserved PDZ and LIM domains. LIM domains are proposed to function in protein-protein recognition in a variety of contexts including gene transcription and development and in cytoskeletal interaction. The LIM domains of this protein bind to protein kinases, whereas the PDZ domain binds to actin filaments. The gene product is involved in the assembly of an actin filament ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000355572
  • ENSP00000347776
  • ENSG00000196923
  • ENST00000355841
  • ENSP00000348099
  • ENST00000359895
  • ENSP00000352964
  • ENST00000393551
  • ENSP00000377182
  • ENST00000486828
  • ENSP00000439157
  • ENST00000493815
  • ENSP00000431236

Symbol
  • ENIGMA
  • LMP1
  • LMP3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.97
disease perturbation
0.96
interacting protein
0.96
disease
0.93
PubMedID
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 287.39   (req: < 5)
Gene RIFs: 30   (req: <= 3)
Antibodies: 132   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 287.39   (req: >= 5)
Gene RIFs: 30   (req: > 3)
Antibodies: 132   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (53)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Developmental Biology
Reactome
RET signaling
Name
Explore in Pharos
Explore in Source
Axon guidance
Developmental Biology
RET signaling
Gene Ontology Terms (13)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (142)
1 – 10 of 142
PTPN14
Tbio
Family: Enzyme
Novelty: 0.01972265
p_int: 0.99992544
p_ni: 0.00007456
Score: 0.246
Data Source: BioPlex,STRINGDB
PDLIM5
Tbio
Novelty: 0.00263369
p_int: 0.999905674
p_ni: 0.000094326
Score: 0.55
Data Source: BioPlex,STRINGDB
ZBTB10
Tbio
Family: TF
Novelty: 0.07696214
p_int: 0.999835631
p_ni: 0.000164369
Score: 0.533
Data Source: BioPlex,STRINGDB
LPXN
Tbio
Novelty: 0.00609819
p_int: 0.999711401
p_ni: 0.000284417
p_wrong: 0.000004181
Score: 0.528
Data Source: BioPlex,STRINGDB
SLFN12
Tbio
Novelty: 0.18123339
p_int: 0.999360398
p_wrong: 0.000639602
Score: 0.282
Data Source: BioPlex,STRINGDB
LPP
Tbio
Novelty: 0.00140516
p_int: 0.994651556
p_ni: 0.0028002
p_wrong: 0.002548244
Score: 0.574
Data Source: BioPlex,STRINGDB
PRICKLE3
Tdark
Novelty: 0.43613707
p_int: 0.993009987
p_ni: 0.006990013
p_wrong: 1e-9
Score: 0.181
Data Source: BioPlex,STRINGDB
BAG3
Tbio
Novelty: 0.00469463
p_int: 0.991687081
p_ni: 0.008312919
Score: 0.178
Data Source: BioPlex,STRINGDB
ZCCHC7
Tbio
Novelty: 0.01414427
p_int: 0.990725156
p_ni: 0.009274844
Score: 0.163
Data Source: BioPlex,STRINGDB
ZNF576
Tdark
Family: TF
p_int: 0.989268555
p_ni: 0.010731443
p_wrong: 2e-9
Score: 0.645
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  287.39

PubMed score by year
PubTator Score  1177.42

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQNKI
1-70
RACGERLSLGLSRAQPVQSKPQKASAPAADPPRYTFAPSVSLNKTARPFGAPPPADSAPQQNGQPLRPLV
70-140
PDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPW
140-210
PGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATPTPLQSRTSIVQAAAGGVPGGGSNNGKTP
210-280
VCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITG
280-350
EIMHALKMTWHVHCFTCAACKTPIRNRAFYMEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFS
350-420
WHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSHV
420-457
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGSLTHIEAQNKIRACGERLSLGLSRAQPVQSKPQKASAPAADPPRYTFAPSVSLNKTARPFGAPPPADSAPQQNGQPLRPLVPDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTRHSQPATPTPLQSRTSIVQAAAGGVPGGGSNNGKTPVCHQCHKVIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPPCYDVRYAPSCAKCKKKITGEIMHALKMTWHVHCFTCAACKTPIRNRAFYMEEGVPYCERDYEKMFGTKCHGCDFKIDAGDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDRPLCKSHAFSHV