You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ZNF302
Zinc finger protein 302

Protein Summary
Description
May be involved in transcriptional regulation. This gene encodes a member of the zinc-finger protein family. The encoded protein contains seven C2H2-type zinc fingers and a KRAB domain, but its function has yet to be determined. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000423823
  • ENSP00000405219
  • ENSG00000089335
  • ENST00000457781
  • ENSP00000391067
  • ENST00000505242
  • ENSP00000421028

Symbol
  • ZNF135L
  • ZNF140L
  • ZNF327
  • HSD16
  • MST154
  • ZNF327
  • MSTP154
  • ZNF135L
  • ZNF140L
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.73
PubMedID
0.65
cell line
0.59
protein domain
0.58
tissue sample
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.79   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 107   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.79   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 107   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
RNA Polymerase II Transcription
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
RNA Polymerase II Transcription
Protein-Protein Interactions (10)
1 – 10 of 10
VWCE
Tbio
Novelty: 0.10129635
p_int: 0.999983725
p_ni: 2.5e-8
p_wrong: 0.00001625
Data Source: BioPlex
TMEM25
Tdark
Novelty: 0.57954545
p_int: 0.986158615
p_ni: 0.013718839
p_wrong: 0.000122546
Data Source: BioPlex
RFPL4B
Tdark
p_int: 0.945127691
p_ni: 4.1e-8
p_wrong: 0.054872268
Score: 0.201
Data Source: BioPlex,STRINGDB
DMC1
Tbio
Novelty: 0.07202881
p_int: 0.864281735
p_ni: 0.135717576
p_wrong: 6.89e-7
Score: 0.327
Data Source: BioPlex,STRINGDB
TRIM28
Tbio
Family: Epigenetic
Novelty: 0.01042773
Score: 0.903
Data Source: STRINGDB
ANKRA2
Tbio
Novelty: 0.29511652
Score: 0.542
Data Source: STRINGDB
ZFYVE16
Tbio
Novelty: 0.155836
Score: 0.53
Data Source: STRINGDB
SCGB2B2
Tdark
Novelty: 1
Score: 0.44
Data Source: STRINGDB
UBA2
Tbio
Novelty: 0.02816874
Score: 0.401
Data Source: STRINGDB
LSM14A
Tbio
Novelty: 0.07175157
Score: 0.4
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.79

PubMed score by year
PubTator Score  0.92

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSQVTFSDVAIDFSHEEWACLDSAQRDLYKDVMVQNYENLVSVGLSVTKPYVIMLLEDGKEPWMMEKKLS
1-70
KAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNSPNSTVEAFSRSKKKKKKKKK
70-140
RQCFAFLIYFRLGIKMGKQGIINKEGYLYEDSPQPVTMEKVVKQSYEFSNSNKNLEYTECDTFRSTFHSK
140-210
STLSEPQNNSAEGNSHKYDILKKNLSKKSVIKSERINGGKKLLNSNKSGAAFNQSKSLTLPQTCNREKIY
210-280
TCSECGKAFGKQSILSRHWRIHTGEKPYECRECGKTFSHGSSLTRHQISHSGEKPYKCIECGKAFSHGSS
280-350
LTNHQSTHTGEKPYECMNCGKSFSRVSLLIQHLRIHTQEKRYECRICGKAFIHSSSLIHHQKSHTGEKPY
350-420
ECRECGKAFCCSSHLTQHQRIHSMKKKYECNKCLKVFSSFSFLVQHQSIHTEEKPFEV
420-478
MSQVTFSDVAIDFSHEEWACLDSAQRDLYKDVMVQNYENLVSVGLSVTKPYVIMLLEDGKEPWMMEKKLSKAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNSPNSTVEAFSRSKKKKKKKKKRQCFAFLIYFRLGIKMGKQGIINKEGYLYEDSPQPVTMEKVVKQSYEFSNSNKNLEYTECDTFRSTFHSKSTLSEPQNNSAEGNSHKYDILKKNLSKKSVIKSERINGGKKLLNSNKSGAAFNQSKSLTLPQTCNREKIYTCSECGKAFGKQSILSRHWRIHTGEKPYECRECGKTFSHGSSLTRHQISHSGEKPYKCIECGKAFSHGSSLTNHQSTHTGEKPYECMNCGKSFSRVSLLIQHLRIHTQEKRYECRICGKAFIHSSSLIHHQKSHTGEKPYECRECGKAFCCSSHLTQHQRIHSMKKKYECNKCLKVFSSFSFLVQHQSIHTEEKPFEV