You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
GPRC5C
G-protein coupled receptor family C group 5 member C

Protein Summary
Description
This retinoic acid-inducible G-protein coupled receptor provide evidence for a possible interaction between retinoid and G-protein signaling pathways. The protein encoded by this gene is a member of the type 3 G protein-coupled receptor family. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. The specific function of this protein is unknown; however, this protein may mediate the cellular effects of retinoic acid on the G protein signal transduction cascade. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000392629
  • ENSP00000376405
  • ENSG00000170412

Symbol
  • RAIG3
  • RAIG3
  • RAIG-3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor
0.89
PubMedID
0.86
gene perturbation
0.83
cell type or tissue
0.76
histone modification site profile
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.72   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 242   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.72   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 242   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (1)
Items per page:
1 – 1 of 1
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
GPCRs, Class C Metabotropic glutamate, pheromone
Name
Explore in Pharos
Explore in Source
GPCRs, Class C Metabotropic glutamate, pheromone
Protein-Protein Interactions (53)
1 – 10 of 53
GOLPH3L
Tbio
Novelty: 0.28509719
p_int: 0.999999334
p_ni: 6.65e-7
p_wrong: 1e-9
Data Source: BioPlex
NMT2
Tchem
Family: Enzyme
Novelty: 0.05657813
p_int: 0.999997128
p_ni: 0.000002869
p_wrong: 3e-9
Data Source: BioPlex
PCYT1A
Tbio
Family: Enzyme
Novelty: 0.00370919
p_int: 0.999985555
p_ni: 0.000014445
Score: 0.181
Data Source: BioPlex,STRINGDB
BAIAP2L1
Tbio
Novelty: 0.0705496
p_int: 0.999984937
p_ni: 0.000015055
p_wrong: 9e-9
Score: 0.173
Data Source: BioPlex,STRINGDB
NMT1
Tchem
Family: Enzyme
Novelty: 0.00436862
p_int: 0.999349867
p_ni: 0.000650133
Data Source: BioPlex
TNFSF18
Tbio
Novelty: 0.01752002
p_int: 0.999341586
p_ni: 0.000658413
p_wrong: 1e-9
Data Source: BioPlex
GOLPH3
Tbio
Novelty: 0.00023848
p_int: 0.995890483
p_ni: 0.004108252
p_wrong: 0.000001265
Data Source: BioPlex
NNT
Tbio
Family: Enzyme
Novelty: 0.00316082
p_int: 0.994608812
p_ni: 0.005391188
Score: 0.161
Data Source: BioPlex,STRINGDB
C17orf75
Tbio
Novelty: 0.1097561
p_int: 0.988360049
p_ni: 0.011623903
p_wrong: 0.000016048
Data Source: BioPlex
FMO1
Tbio
Family: Enzyme
Novelty: 0.03152164
p_int: 0.964132153
p_ni: 0.03586781
p_wrong: 3.7e-8
Data Source: BioPlex
Publication Statistics
PubMed Score  4.72

PubMed score by year
PubTator Score  2.14

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAIHKALVMCLGLPLFLFPGAWAQGHVPPGCSQGLNPLYYNLCDRSGAWGIVLEAVAGAGIVTTFVLTII
1-70
LVASLPFVQDTKKRSLLGTQVFFLLGTLGLFCLVFACVVKPDFSTCASRRFLFGVLFAICFSCLAAHVFA
70-140
LNFLARKNHGPRGWVIFTVALLLTLVEVIINTEWLIITLVRGSGEGGPQGNSSAGWAVASPCAIANMDFV
140-210
MALIYVMLLLLGAFLGAWPALCGRYKRWRKHGVFVLLTTATSVAIWVVWIVMYTYGNKQHNSPTWDDPTL
210-280
AIALAANAWAFVLFYVIPEVSQVTKSSPEQSYQGDMYPTRGVGYETILKEQKGQSMFVENKAFSMDEPVA
280-350
AKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQ
350-420
AATPPKDGKNSQVFRNPYVWD
420-441
MAIHKALVMCLGLPLFLFPGAWAQGHVPPGCSQGLNPLYYNLCDRSGAWGIVLEAVAGAGIVTTFVLTIILVASLPFVQDTKKRSLLGTQVFFLLGTLGLFCLVFACVVKPDFSTCASRRFLFGVLFAICFSCLAAHVFALNFLARKNHGPRGWVIFTVALLLTLVEVIINTEWLIITLVRGSGEGGPQGNSSAGWAVASPCAIANMDFVMALIYVMLLLLGAFLGAWPALCGRYKRWRKHGVFVLLTTATSVAIWVVWIVMYTYGNKQHNSPTWDDPTLAIALAANAWAFVLFYVIPEVSQVTKSSPEQSYQGDMYPTRGVGYETILKEQKGQSMFVENKAFSMDEPVAAKRPVSPYSGYNGQLLTSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRNPYVWD