You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LUC7L
Putative RNA-binding protein Luc7-like 1

Protein Summary
Description
May bind to RNA via its Arg/Ser-rich domain. The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]).[supplied by OMIM, Mar 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000293872
  • ENSP00000293872
  • ENSG00000007392
  • ENST00000337351
  • ENSP00000337507
  • ENST00000397783
  • ENSP00000380885

Symbol
  • LUC7L1
  • Luc7
  • SR+89
  • LUC7B1
  • hLuc7B1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
disease perturbation
0.95
transcription factor binding site profile
0.85
kinase perturbation
0.84
interacting protein
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.98   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 208   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.98   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 208   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (7)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (167)
1 – 10 of 167
JMJD6
Tbio
Family: Enzyme
Novelty: 0.00134844
p_int: 0.999999991
p_ni: 9e-9
Score: 0.318
Data Source: BioPlex,STRINGDB
GPATCH8
Tdark
Novelty: 0.59308072
p_int: 0.999999632
p_ni: 3.68e-7
Score: 0.22
Data Source: BioPlex,STRINGDB
PRPF38B
Tdark
Novelty: 3
p_int: 0.999989474
p_ni: 0.000003116
p_wrong: 0.00000741
Score: 0.769
Data Source: BioPlex,STRINGDB
NFKBIL1
Tbio
Novelty: 0.03797332
p_int: 0.999972301
p_ni: 0.000027698
p_wrong: 1e-9
Score: 0.542
Data Source: BioPlex,STRINGDB
PNN
Tbio
Novelty: 0.00945912
p_int: 0.999759511
p_ni: 0.000240489
Score: 0.413
Data Source: BioPlex,STRINGDB
CLK3
Tchem
Family: Kinase
Novelty: 0.02788904
p_int: 0.999731394
p_ni: 0.000268606
Score: 0.557
Data Source: BioPlex,STRINGDB
NKTR
Tbio
Novelty: 0.01971091
p_int: 0.999679324
p_ni: 0.000320676
Score: 0.293
Data Source: BioPlex,STRINGDB
C1QBP
Tbio
Novelty: 0.00278686
p_int: 0.999377402
p_ni: 0.000622598
Data Source: BioPlex
SRSF8
Tdark
Novelty: 0.32258065
p_int: 0.999170947
p_ni: 0.000393721
p_wrong: 0.000435333
Score: 0.457
Data Source: BioPlex,STRINGDB
LUC7L2
Tdark
Novelty: 0.46134191
p_int: 0.999001895
p_ni: 0.000998105
Score: 0.549
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  11.98

PubMed score by year
PubTator Score  49.24

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRAD
1-70
YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKA
70-140
EQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHF
140-210
GGKLHLGFIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRS
210-280
RSTSRERRKLSRSRSRDRHRRHRSRSRSHSRGHRRASRDRSAKYKFSRERASREESWESGRSERGPPDWR
280-350
LESSNGKMASRRSEEKEAGEI
350-371
MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKLSRSRSRDRHRRHRSRSRSHSRGHRRASRDRSAKYKFSRERASREESWESGRSERGPPDWRLESSNGKMASRRSEEKEAGEI