You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ACKR4
Atypical chemokine receptor 4

Protein Summary
Description
Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines CCL2, CCL8, CCL13, CCL19, CCL21 and CCL25. Chemokine-binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization. Plays an important role in controlling the migration of immune and cancer cells that express chemokine receptors CCR7 and CCR9, by reducing the availability of CCL19, CCL21, and CCL25 through internalization. Negatively regulates CXCR3-induced chemotaxis. Regulates T-cell development in the thymus. The protein encoded by this gene is a member of the G protein-coupled receptor family, and ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000249887
  • ENSP00000249887
  • ENSG00000129048

Symbol
  • CCBP2
  • CCR11
  • CCRL1
  • VSHK1
  • PPR1
  • CCBP2
  • CCR10
  • CCR11
  • CCRL1
  • VSHK1
  • CCR-11
  • CKR-11
  • CCX CKR
  • CCX-CKR
  • CC-CKR-11
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.75
ligand (protein)
0.68
cell type or tissue
0.67
molecular function
0.63
tissue
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 84.79   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 230   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 84.79   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 230   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (9)
Chemokine receptors bind chemokines (R-HSA-380108)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Chemokine receptors bind chemokines
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
GPCR ligand binding
Reactome
Peptide ligand-binding receptors
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Chemokine receptors bind chemokines
Class A/1 (Rhodopsin-like receptors)
GPCR ligand binding
Peptide ligand-binding receptors
Signal Transduction
Gene Ontology Terms (16)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (37)
1 – 10 of 37
CCL19
Tbio
Novelty: 0.00235957
Score: 0.971
Data Source: Reactome,STRINGDB
CCL21
Tbio
Novelty: 0.0007729
Score: 0.971
Data Source: Reactome,STRINGDB
CCL25
Tbio
Novelty: 0.01203102
Score: 0.97
Data Source: Reactome,STRINGDB
CCL27
Tbio
Novelty: 0.00170502
Score: 0.83
Data Source: STRINGDB
CCL8
Tbio
Novelty: 0.0062709
Score: 0.753
Data Source: STRINGDB
ACKR1
Tbio
Family: GPCR
Novelty: 0.0013938
Score: 0.711
Data Source: STRINGDB
CCL5
Tchem
Novelty: 0.00039604
Score: 0.647
Data Source: STRINGDB
CXCL13
Tbio
Novelty: 0.00156696
Score: 0.623
Data Source: STRINGDB
CCL2
Tchem
Novelty: 0.00013411
Score: 0.602
Data Source: STRINGDB
CCL11
Tbio
Novelty: 0.00099166
Score: 0.6
Data Source: STRINGDB
Publication Statistics
PubMed Score  84.79

PubMed score by year
PubTator Score  21.15

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MALEQNQSTDYYYEENEMNGTYDYSQYELICIKEDVREFAKVFLPVFLTIVFVIGLAGNSMVVAIYAYYK
1-70
KQRTKTDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGKIMCKITSALYTLNFVSGMQFLACISIDRYVA
70-140
VTKVPSQSGVGKPCWIICFCVWMAAILLSIPQLVFYTVNDNARCIPIFPRYLGTSMKALIQMLEICIGFV
140-210
VPFLIMGVCYFITARTLMKMPNIKISRPLKVLLTVVIVFIVTQLPYNIVKFCRAIDIIYSLITSCNMSKR
210-280
MDIAIQVTESIALFHSCLNPILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSEGPTEPTSTFSI
280-350
MALEQNQSTDYYYEENEMNGTYDYSQYELICIKEDVREFAKVFLPVFLTIVFVIGLAGNSMVVAIYAYYKKQRTKTDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGKIMCKITSALYTLNFVSGMQFLACISIDRYVAVTKVPSQSGVGKPCWIICFCVWMAAILLSIPQLVFYTVNDNARCIPIFPRYLGTSMKALIQMLEICIGFVVPFLIMGVCYFITARTLMKMPNIKISRPLKVLLTVVIVFIVTQLPYNIVKFCRAIDIIYSLITSCNMSKRMDIAIQVTESIALFHSCLNPILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSEGPTEPTSTFSI