You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CABP2
Calcium-binding protein 2

Protein Classes
Protein Summary
Description
Required for sound encoding at inner hair cells (IHCs) synapses, likely via inhibition of the inactivation of voltage-gated calcium channel of type 1.3 (Cav1.3) in the IHCs (PubMed:28183797). Required for the normal transfer of light signals through the retina (By similarity). This gene belongs to a subfamily of calcium binding proteins that share similarity to calmodulin. Like calmodulin, these family members can likely stimulate calmodulin-dependent kinase II and the protein phosphatase calcineurin. Calcium binding proteins are an important component of calcium mediated cellular signal transduction. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000294288
  • ENSP00000294288
  • ENSG00000167791
  • ENST00000353903
  • ENSP00000312037

Symbol
  • DFNB93
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.85
protein domain
0.58
cell line
0.55
gene perturbation
0.51
cellular component
0.46


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.64   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 106   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.64   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 106   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (8)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (44)
1 – 10 of 44
RIBC1
Tdark
Novelty: 0.55837563
Score: 0.711
Data Source: STRINGDB
GRK5
Tchem
Family: Kinase
Novelty: 0.01219315
Score: 0.706
Data Source: STRINGDB
TERB2
Tdark
Novelty: 1.42857143
Score: 0.695
Data Source: STRINGDB
C1orf43
Tdark
Novelty: 0.23734247
Score: 0.681
Data Source: STRINGDB
CACNA1D
Tclin
Family: IC
Novelty: 0.00242625
Score: 0.655
Data Source: STRINGDB
HAND2
Tbio
Family: TF
Novelty: 0.00439742
Score: 0.641
Data Source: STRINGDB
MYH10
Tbio
Novelty: 0.00811239
Score: 0.634
Data Source: STRINGDB
FBXO22
Tbio
Novelty: 0.161141
Score: 0.616
Data Source: STRINGDB
CACNA1F
Tchem
Family: IC
Novelty: 0.0041671
Score: 0.604
Data Source: STRINGDB
OBSCN
Tbio
Family: Kinase
Novelty: 0.01608231
Score: 0.601
Data Source: STRINGDB
Publication Statistics
PubMed Score  8.64

PubMed score by year
PubTator Score  4.39

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGNCAKRPWRRGPKDPLQWLGSPPRGSCPSPSSSPKEQGDPAPGVQGYSVLNSLVGPACIFLRPSIAATQ
1-70
LDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELIEISQQISGGKVDFEDFVELM
70-140
GPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALLGERLSQREVDEILQDVDLNGDGLVD
140-210
FEEFVRMMSR
210-220
MGNCAKRPWRRGPKDPLQWLGSPPRGSCPSPSSSPKEQGDPAPGVQGYSVLNSLVGPACIFLRPSIAATQLDRELRPEEIEELQVAFQEFDRDRDGYIGCRELGACMRTLGYMPTEMELIEISQQISGGKVDFEDFVELMGPKLLAETADMIGVRELRDAFREFDTNGDGRISVGELRAALKALLGERLSQREVDEILQDVDLNGDGLVDFEEFVRMMSR