You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
EMC7
ER membrane protein complex subunit 7

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000256545
  • ENSP00000256545
  • ENSG00000134153

Symbol
  • C11orf3
  • C15orf24
  • HT022
  • C11orf3
  • C15orf24
  • ORF1-FL1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.97
transcription factor perturbation
0.94
histone modification site profile
0.92
kinase perturbation
0.76
transcription factor binding site profile
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.76   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 44   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.76   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 44   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (3)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (71)
1 – 10 of 71
EMC3
Tbio
Novelty: 0.01516701
p_int: 1
Score: 0.996
Data Source: BioPlex,STRINGDB
EMC9
Tdark
Novelty: 7
p_int: 0.999999987
p_ni: 1.3e-8
Score: 0.996
Data Source: BioPlex,STRINGDB
EMC2
Tbio
Novelty: 0.1393497
p_int: 0.999996396
p_ni: 0.000003604
Score: 0.993
Data Source: BioPlex,STRINGDB
EMC8
Tdark
Novelty: 1
p_int: 0.999954925
p_ni: 0.000045075
Score: 0.996
Data Source: BioPlex,STRINGDB
EMC6
Tbio
Novelty: 0.26086957
p_int: 0.999863248
p_ni: 0.000136752
Score: 0.996
Data Source: BioPlex,STRINGDB
EMC10
Tbio
Novelty: 0.08511187
p_int: 0.998966362
p_ni: 0.001033007
p_wrong: 6.31e-7
Score: 0.997
Data Source: BioPlex,STRINGDB
EMC1
Tbio
Novelty: 0.08648203
p_int: 0.988583394
p_ni: 0.011416606
Score: 0.995
Data Source: BioPlex,STRINGDB
APOA2
Tbio
Novelty: 0.00133324
p_int: 0.97977133
p_ni: 0.020228663
p_wrong: 7e-9
Data Source: BioPlex
EMC4
Tdark
Novelty: 0.23166023
p_int: 0.973544657
p_ni: 0.026455073
p_wrong: 2.71e-7
Score: 0.996
Data Source: BioPlex,STRINGDB
MMGT1
Tdark
Novelty: 0.19354839
p_int: 0.968036673
p_ni: 0.031963328
Score: 0.995
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  0.76

PubMed score by year
PubTator Score  0.13

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAALWGFFPVLLLLLLSGDVQSSEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVD
1-70
GEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQM
70-140
KSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLPKVVNTSDPDMRREMEQSMNMLNSNHELPDV
140-210
SEFMTRLFSSKSSGKSSSGSSKTGKSGAGKRR
210-242
MAAALWGFFPVLLLLLLSGDVQSSEVPGAAAEGSGGSGVGIGDRFKIEGRAVVPGVKPQDWISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLPKVVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKTGKSGAGKRR