You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
SINHCAF
SIN3-HDAC complex-associated factor

Protein Summary
Description
Subunit of the Sin3 deacetylase complex (Sin3/HDAC), this subunit is important for the repression of genes encoding components of the TGF-beta signaling pathway (PubMed:22865885, PubMed:22984288). Core component of a SIN3A complex (composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1) present in embryonic stem (ES) cells. Promotes the stability of SIN3A and its presence on chromatin and is essential for maintaining the potential of ES cells to proliferate rapidly, while ensuring a short G1-phase of the cell cycle, thereby preventing premature lineage priming (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000337682
  • ENSP00000337477
  • ENSG00000139146
  • ENST00000454658
  • ENSP00000393279
  • ENST00000539409
  • ENSP00000443697
  • ENST00000542983
  • ENSP00000439952
  • ENST00000617411
  • ENSP00000479093
  • ENSG00000276371
  • ENST00000631598
  • ENSP00000488852
  • ENST00000633702
  • ENSP00000488570
  • ENST00000633815
  • ENSP00000488406

Symbol
  • C12orf14
  • FAM60A
  • L4
  • TERA
  • FAM60A
  • C12orf14
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.95   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 42   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4.95   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 42   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (108)
1 – 10 of 108
ING2
Tbio
Family: Epigenetic
Novelty: 0.0302122
p_int: 1
Score: 0.972
Data Source: BioPlex,STRINGDB
RBBP7
Tbio
Novelty: 0.02883677
p_int: 1
Score: 0.958
Data Source: BioPlex,STRINGDB
HDAC1
Tclin
Family: Epigenetic
Novelty: 0.00083441
p_int: 1
Score: 0.941
Data Source: BioPlex,STRINGDB
SAP130
Tdark
Family: Enzyme
p_int: 0.999999987
p_ni: 1.1e-8
p_wrong: 1e-9
Score: 0.838
Data Source: BioPlex,STRINGDB
ARID4A
Tbio
Family: TF; Epigenetic
Novelty: 0.036284
p_int: 0.999999982
p_ni: 1.8e-8
Score: 0.777
Data Source: BioPlex,STRINGDB
ARID4B
Tbio
Family: TF; Epigenetic
Novelty: 0.05116399
p_int: 0.999999982
p_ni: 1.8e-8
Score: 0.457
Data Source: BioPlex,STRINGDB
SUDS3
Tbio
Family: Enzyme
Novelty: 0.02419541
p_int: 0.999999974
p_ni: 2.6e-8
Score: 0.913
Data Source: BioPlex,STRINGDB
BRMS1
Tbio
Novelty: 0.01896458
p_int: 0.999999955
p_ni: 4.4e-8
p_wrong: 1e-9
Score: 0.773
Data Source: BioPlex,STRINGDB
SAP30
Tbio
Family: Enzyme
Novelty: 0.05788749
p_int: 0.999999935
p_ni: 6.5e-8
Score: 0.967
Data Source: BioPlex,STRINGDB
SIN3A
Tbio
Novelty: 0.01059111
p_int: 0.99999991
p_ni: 8.7e-8
p_wrong: 3e-9
Score: 0.965
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  4.95

PubMed score by year
PubTator Score  6.93

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGS
1-70
KKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQ
70-140
SDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQG
140-210
PEPLPISTQEW
210-221
MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW