You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GP6
Platelet glycoprotein VI

Protein Summary
Description
Collagen receptor involved in collagen-induced platelet adhesion and activation. Plays a key role in platelet procoagulant activity and subsequent thrombin and fibrin formation. This procoagulant function may contribute to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely FYN or LYN) and SYK, the adapter protein LAT and leads to the activation of PLCG2. This gene encodes a platelet membrane glycoprotein of the immunoglobulin superfamily. The encoded protein is a receptor for collagen and plays a critical role in collagen-induced platelet aggregation and thrombus formation. The encoded protein forms a complex with the Fc receptor gamma-chain that initiates the platelet activation signaling cascade upon collagen binding. Mutations in this gene are a cause of platelet-type bleeding disorder-11 (BDPLT11). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSe ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000310373
  • ENSP00000308782
  • ENSG00000088053
  • ENST00000333884
  • ENSP00000334552
  • ENST00000417454
  • ENSP00000394922
  • ENST00000612184
  • ENSP00000479873
  • ENSG00000277439
  • ENST00000616456
  • ENSP00000483314
  • ENST00000622279
  • ENSP00000484029

Symbol
  • GPIV
  • GPVI
  • BDPLT11
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.93
cellular component
0.79
disease
0.78
cell type or tissue
0.75
tissue sample
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 693.69   (req: < 5)
Gene RIFs: 149   (req: <= 3)
Antibodies: 269   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 693.69   (req: >= 5)
Gene RIFs: 149   (req: > 3)
Antibodies: 269   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (7)
Cell surface interactions at the vascular wall (R-HSA-202733)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell surface interactions at the vascular wall
Reactome
GPVI-mediated activation cascade
Reactome
Hemostasis
Reactome
Platelet Adhesion to exposed collagen
Reactome
Platelet activation, signaling and aggregation
Name
Explore in Pharos
Explore in Source
Cell surface interactions at the vascular wall
GPVI-mediated activation cascade
Hemostasis
Platelet Adhesion to exposed collagen
Platelet activation, signaling and aggregation
Protein-Protein Interactions (88)
1 – 10 of 88
FCER1G
Tbio
Novelty: 0.00930179
Score: 0.976
Data Source: Reactome,STRINGDB
SYK
Tclin
Family: Kinase
Novelty: 0.00067612
Score: 0.971
Data Source: Reactome,STRINGDB
LYN
Tclin
Family: Kinase
Novelty: 0.00137519
Score: 0.969
Data Source: Reactome,STRINGDB
FYN
Tclin
Family: Kinase
Novelty: 0.00092113
Score: 0.966
Data Source: Reactome,STRINGDB
LCP2
Tbio
Novelty: 0.00631737
Score: 0.957
Data Source: STRINGDB
MPIG6B
Tbio
Novelty: 0.07013592
Score: 0.954
Data Source: STRINGDB
LAT
Tbio
Novelty: 0.00738606
Score: 0.949
Data Source: STRINGDB
VAV1
Tchem
Novelty: 0.00223848
Score: 0.934
Data Source: STRINGDB
VAV3
Tbio
Novelty: 0.01366247
Score: 0.932
Data Source: STRINGDB
PTPN11
Tchem
Family: Enzyme
Novelty: 0.00086268
Score: 0.93
Data Source: STRINGDB
Publication Statistics
PubMed Score  693.69

PubMed score by year
PubTator Score  497.87

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQ
1-70
AVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGF
70-140
DQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPS
140-210
RLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVIL
210-280
IILAGFLAEDWHSRRKRLRHRGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS
280-339
MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRHRGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS