You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SYTL2
Synaptotagmin-like protein 2

Protein Summary
Description
Isoform 1 acts as a RAB27A effector protein and plays a role in cytotoxic granule exocytosis in lymphocytes. It is required for cytotoxic granule docking at the immunologic synapse. Isoform 4 binds phosphatidylserine (PS) and phosphatidylinositol-4,5-bisphosphate (PIP2) and promotes the recruitment of glucagon-containing granules to the cell membrane in pancreatic alpha cells. Binding to PS is inhibited by Ca(2+) while binding to PIP2 is Ca(2+) insensitive. The protein encoded by this gene is a synaptotagmin-like protein (SLP) that belongs to a C2 domain-containing protein family. The SLP homology domain (SHD) of this protein has been shown to specifically bind the GTP-bound form of Ras-related protein Rab-27A (RAB27A). This protein plays a role in RAB27A-dependent vesicle trafficking and controls melanosome distribution in the cell periphery. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Jun 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000316356
  • ENSP00000318803
  • ENSG00000137501
  • ENST00000359152
  • ENSP00000352065
  • ENST00000389958
  • ENSP00000374608
  • ENST00000389960
  • ENSP00000374610
  • ENST00000524452
  • ENSP00000435238
  • ENST00000525702
  • ENSP00000432996
  • ENST00000527523
  • ENSP00000434010
  • ENST00000528231
  • ENSP00000431701
  • ENST00000529581
  • ENSP00000435855
  • ENST00000533892
  • ENSP00000432144

Symbol
  • KIAA1597
  • SGA72M
  • SLP2
  • SLP2A
  • EXO4
  • SLP2
  • SLP2A
  • SGA72M
  • CHR11SYT
  • PPP1R151
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.9
small molecule perturbation
0.89
gene perturbation
0.84
transcription factor perturbation
0.84
cellular component
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.85   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 72   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.85   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 72   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (1)
Items per page:
1 – 1 of 1
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Deregulation of Rab and Rab Effector Genes in Bladder Cancer
Name
Explore in Pharos
Explore in Source
Deregulation of Rab and Rab Effector Genes in Bladder Cancer
Gene Ontology Terms (18)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (32)
1 – 10 of 32
RAB27B
Tbio
Family: Enzyme
Novelty: 0.0195563
p_int: 1
Score: 0.838
Data Source: BioPlex,STRINGDB
RAB27A
Tchem
Family: Enzyme
Novelty: 0.00463277
p_int: 0.999999946
p_ni: 5.4e-8
Score: 0.968
Data Source: BioPlex,STRINGDB
MLPH
Tbio
Novelty: 0.02388794
Score: 0.761
Data Source: STRINGDB
RAP2B
Tbio
Family: Enzyme
Novelty: 0.00404787
Score: 0.649
Data Source: STRINGDB
ARF3
Tbio
Family: Enzyme
Novelty: 0.00403923
Score: 0.646
Data Source: STRINGDB
CHML
Tbio
Family: Enzyme
Novelty: 0.0116075
Score: 0.63
Data Source: STRINGDB
MYRIP
Tbio
Novelty: 0.09502588
Score: 0.602
Data Source: STRINGDB
UNC13D
Tbio
Novelty: 0.01151864
Score: 0.594
Data Source: STRINGDB
MYO5A
Tbio
Novelty: 0.00498077
Score: 0.562
Data Source: STRINGDB
DHX38
Tbio
Family: Enzyme
Novelty: 0.02322174
Score: 0.561
Data Source: STRINGDB
Publication Statistics
PubMed Score  18.85

PubMed score by year
PubTator Score  34.64

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MIDLSFLTEEEQEAIMKVLQRDAALKRAEEERVRHLPEKIKDDQQLKNMSGQWFYEAKAKRHRDKIHGAD
1-70
IIRASMRKKRPQIAAEQSKDRENGAKESWVNNVNKDAFLPPELAGVVEEPEEDAAPASPSSSVVNPASSV
70-140
IDMSQENTRKPNVSPEKRKNPFNSSKLPEGHSSQQTKNEQSKNGRTGLFQTSKEDELSESKEKSTVADTS
140-210
IQKLEKSKQTLPGLSNGSQIKAPIPKARKMIYKSTDLNKDDNQSFPRQRTDSLKARGAPRGILKRNSSSS
210-280
STDSETLRYNHNFEPKSKIVSPGLTIHERISEKEHSLEDNSSPNSLEPLKHVRFSAVKDELPQSPGLIHG
280-350
REVGEFSVLESDRLKNGMEDAGDTEEFQSDPKPSQYRKPSLFHQSTSSPYVSKSETHQPMTSGSFPINGL
350-420
HSHSEVLTARPQSMENSPTINEPKDKSSELTRLESVLPRSPADELSHCVEPEPSQVPGGSSRDRQQGSEE
420-490
EPSPVLKTLERSAARKMPSKSLEDISSDSSNQAKVDNQPEELVRSAEDVSTVPTQPDNPFSHPDKLKRMS
490-560
KSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEVKG
560-630
NIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNEIL
630-700
RYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAENRG
700-770
EMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKTTN
770-840
PIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWEKM
840-910
VNSPNTWIEATLPLRMLLIAKISK
910-934
MIDLSFLTEEEQEAIMKVLQRDAALKRAEEERVRHLPEKIKDDQQLKNMSGQWFYEAKAKRHRDKIHGADIIRASMRKKRPQIAAEQSKDRENGAKESWVNNVNKDAFLPPELAGVVEEPEEDAAPASPSSSVVNPASSVIDMSQENTRKPNVSPEKRKNPFNSSKLPEGHSSQQTKNEQSKNGRTGLFQTSKEDELSESKEKSTVADTSIQKLEKSKQTLPGLSNGSQIKAPIPKARKMIYKSTDLNKDDNQSFPRQRTDSLKARGAPRGILKRNSSSSSTDSETLRYNHNFEPKSKIVSPGLTIHERISEKEHSLEDNSSPNSLEPLKHVRFSAVKDELPQSPGLIHGREVGEFSVLESDRLKNGMEDAGDTEEFQSDPKPSQYRKPSLFHQSTSSPYVSKSETHQPMTSGSFPINGLHSHSEVLTARPQSMENSPTINEPKDKSSELTRLESVLPRSPADELSHCVEPEPSQVPGGSSRDRQQGSEEEPSPVLKTLERSAARKMPSKSLEDISSDSSNQAKVDNQPEELVRSAEDVSTVPTQPDNPFSHPDKLKRMSKSVPAFLQDESDDRETDTASESSYQLSRHKKSPSSLTNLSSSSGMTSLSSVSGSVMSVYSGDFGNLEVKGNIQFAIEYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKAYLLPDKGKMGKKKTLVVKKTLNPVYNEILRYKIEKQILKTQKLNLSIWHRDTFKRNSFLGEVELDLETWDWDNKQNKQLRWYPLKRKTAPVALEAENRGEMKLALQYVPEPVPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKTTNPIFNHTMVYDGFRPEDLMEACVELTVWDHYKLTNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWEKMVNSPNTWIEATLPLRMLLIAKISK