You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
EML4
Echinoderm microtubule-associated protein-like 4

Protein Summary
Description
May modify the assembly dynamics of microtubules, such that microtubules are slightly longer, but more dynamic. This gene is a member of the echinoderm microtubule associated protein-like family. The encoded WD-repeat protein may be involved in microtubule formation. Abnormal fusion of parts of this gene with portions of the anaplastic lymphoma receptor tyrosine kinase gene, which generates EML4-ALK fusion transcripts, is one of the primary mutations associated with non-small cell lung cancer. Alternative splicing of this gene results in two transcript variants. [provided by RefSeq, Jan 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000318522
  • ENSP00000320663
  • ENSG00000143924
  • ENST00000402711
  • ENSP00000385059

Symbol
  • C2orf2
  • EMAPL4
  • C2orf2
  • ELP120
  • EMAP-4
  • EMAPL4
  • ROPP120
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
microRNA
0.81
transcription factor perturbation
0.8
transcription factor
0.79
cell type or tissue
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 222.43   (req: < 5)
Gene RIFs: 65   (req: <= 3)
Antibodies: 122   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 222.43   (req: >= 5)
Gene RIFs: 65   (req: > 3)
Antibodies: 122   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (168)
Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
Non-small cell lung cancer
KEGG
PD-L1 expression and PD-1 checkpoint pathway in cancer
KEGG
Pathways in cancer
Name
Explore in Pharos
Explore in Source
Non-small cell lung cancer
PD-L1 expression and PD-1 checkpoint pathway in cancer
Pathways in cancer
Gene Ontology Terms (8)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (125)
1 – 10 of 125
EML1
Tbio
Novelty: 0.0073518
p_int: 0.999993669
p_ni: 0.000006331
Score: 0.935
Data Source: BioPlex,STRINGDB
FBXO28
Tbio
Novelty: 0.12833512
p_int: 0.999936798
p_ni: 0.000063202
Data Source: BioPlex
TUBB2A
Tclin
Novelty: 0.02116297
p_int: 0.997125554
p_ni: 0.002874446
Score: 0.69
Data Source: BioPlex,STRINGDB
SKP1
Tbio
Family: Enzyme
Novelty: 0.00209659
p_int: 0.99138697
p_ni: 0.00861303
Score: 0.155
Data Source: BioPlex,STRINGDB
TUBB3
Tclin
Novelty: 0.00281462
p_int: 0.96601376
p_ni: 0.03398624
Score: 0.264
Data Source: BioPlex,STRINGDB
TUBB2B
Tclin
Novelty: 0.04266415
p_int: 0.933092514
p_ni: 0.066907486
Score: 0.566
Data Source: BioPlex,STRINGDB
CTAGE5
Tbio
Novelty: 0.06289332
p_int: 0.883167901
p_ni: 0.116832099
Data Source: BioPlex
TUBB
Tclin
Novelty: 0.00489923
p_int: 0.784995523
p_ni: 0.215004477
Score: 0.755
Data Source: BioPlex,STRINGDB
PRPS1
Tbio
Family: Kinase
Novelty: 0.0114331
p_int: 0.781126394
p_ni: 0.218873579
p_wrong: 2.6e-8
Score: 0.185
Data Source: BioPlex,STRINGDB
TKT
Tchem
Family: Enzyme
Novelty: 0.0027011
p_int: 0.77950287
p_ni: 0.22049713
Data Source: BioPlex
Publication Statistics
PubMed Score  222.43

PubMed score by year
PubTator Score  289.31

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDGFAGSLDDSISAASTSDVQDRLSALESRVQQQEDEITVLKAALADVLRRLAISEDHVASVKKSVSSKG
1-70
QPSPRAVIPMSCITNGSGANRKPSHTSAVSIAGKETLSSAAKSGTEKKKEKPQGQREKKEESHSNDQSPQ
70-140
IRASPSPQPSSQPLQIHRQTPESKNATPTKSIKRPSPAEKSHNSWENSDDSRNKLSKIPSTPKLIPKVTK
140-210
TADKHKDVIINQEGEYIKMFMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEWAYGYRGKDCRANVYLLP
210-280
TGKIVYFIASVVVLFNYEERTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSVT
280-350
LSTLQIIGLGTFERGVGCLDFSKADSGVHLCIIDDSNEHMLTVWDWQKKAKGAEIKTTNEVVLAVEFHPT
350-420
DANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGDVLTGDSGGVMLIWSKTTVEPT
420-490
PGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDLNPEREIEVPDQYGTIRAVAE
490-560
GKADQFLVGTSRNFILRGTFNDGFQIEVQGHTDELWGLATHPFKDLLLTCAQDRQVCLWNSMEHRLEWTR
560-630
LVDEPGHCADFHPSGTVVAIGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSIDGTFLAVGSHDNFIY
630-700
LYVVSENGRKYSRYGRCTGHSSYITHLDWSPDNKYIMSNSGDYEILYWDIPNGCKLIRNRSDCKDIDWTT
700-770
YTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHKYSAHSSHVTNV
770-840
SFTHNDSHLISTGGKDMSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTESVIQSNTPTPPPSQPLNETA
840-910
EEESRISSSPTLLENSLEQTVEPSEDHSEEESEEGSGDLGEPLYEEPCNEISKEQAKATLLEDQQDPSPS
910-980
S
980-981
MDGFAGSLDDSISAASTSDVQDRLSALESRVQQQEDEITVLKAALADVLRRLAISEDHVASVKKSVSSKGQPSPRAVIPMSCITNGSGANRKPSHTSAVSIAGKETLSSAAKSGTEKKKEKPQGQREKKEESHSNDQSPQIRASPSPQPSSQPLQIHRQTPESKNATPTKSIKRPSPAEKSHNSWENSDDSRNKLSKIPSTPKLIPKVTKTADKHKDVIINQEGEYIKMFMRGRPITMFIPSDVDNYDDIRTELPPEKLKLEWAYGYRGKDCRANVYLLPTGKIVYFIASVVVLFNYEERTQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSVTLSTLQIIGLGTFERGVGCLDFSKADSGVHLCIIDDSNEHMLTVWDWQKKAKGAEIKTTNEVVLAVEFHPTDANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGDVLTGDSGGVMLIWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDLNPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGTFNDGFQIEVQGHTDELWGLATHPFKDLLLTCAQDRQVCLWNSMEHRLEWTRLVDEPGHCADFHPSGTVVAIGTHSGRWFVLDAETRDLVSIHTDGNEQLSVMRYSIDGTFLAVGSHDNFIYLYVVSENGRKYSRYGRCTGHSSYITHLDWSPDNKYIMSNSGDYEILYWDIPNGCKLIRNRSDCKDIDWTTYTCVLGFQVFGVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHKYSAHSSHVTNVSFTHNDSHLISTGGKDMSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTESVIQSNTPTPPPSQPLNETAEEESRISSSPTLLENSLEQTVEPSEDHSEEESEEGSGDLGEPLYEEPCNEISKEQAKATLLEDQQDPSPSS