You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LGR6
Leucine-rich repeat-containing G-protein coupled receptor 6

Protein Summary
Description
Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and acts as a marker of multipotent stem cells in the epidermis. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. In contrast to classical G-protein coupled receptors, does not activate heterotrimeric G-proteins to transduce the signal. May act as a tumor suppressor. This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane protein superfamily. The encoded protein is a glycoprotein hormone receptor with a large N-terminal extracellular domain that contains leucine-rich repeats important for the formation of a horseshoe-shaped interaction motif for ligand binding. Alternative splicing of this gene results in multiple transcript variants. [provided by R ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000255432
  • ENSP00000255432
  • ENSG00000133067
  • ENST00000367278
  • ENSP00000356247
  • ENST00000439764
  • ENSP00000387869

Symbol
  • GPCR
  • VTS20631
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
ligand (protein)
0.85
protein domain
0.73
transcription factor binding site profile
0.7
cell type or tissue
0.67
PubMedID
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 36.23   (req: < 5)
Gene RIFs: 7   (req: <= 3)
Antibodies: 320   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 36.23   (req: >= 5)
Gene RIFs: 7   (req: > 3)
Antibodies: 320   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
Regulation of FZD by ubiquitination (R-HSA-4641263)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Regulation of FZD by ubiquitination
Reactome
Signal Transduction
Reactome
Signaling by WNT
Reactome
TCF dependent signaling in response to WNT
Name
Explore in Pharos
Explore in Source
Regulation of FZD by ubiquitination
Signal Transduction
Signaling by WNT
TCF dependent signaling in response to WNT
Protein-Protein Interactions (36)
1 – 10 of 36
RSPO1
Tbio
Novelty: 0.0045229
Score: 0.974
Data Source: Reactome,STRINGDB
RSPO3
Tbio
Novelty: 0.03474798
Score: 0.969
Data Source: Reactome,STRINGDB
RSPO4
Tbio
Novelty: 0.07909562
Score: 0.968
Data Source: Reactome,STRINGDB
RSPO2
Tbio
Novelty: 0.02900145
Score: 0.967
Data Source: Reactome,STRINGDB
ZNRF3
Tbio
Family: Enzyme
Novelty: 0.05707008
Score: 0.96
Data Source: Reactome,STRINGDB
RNF43
Tbio
Family: Enzyme
Novelty: 0.01363497
Score: 0.955
Data Source: Reactome,STRINGDB
LGR4
Tbio
Family: GPCR
Novelty: 0.01548681
Score: 0.91
Data Source: STRINGDB
LGR5
Tbio
Family: GPCR
Novelty: 0.00156297
Score: 0.908
Data Source: STRINGDB
UBC
Tbio
Novelty: 0.00161137
Score: 0.905
Data Source: STRINGDB
UBB
Tbio
Novelty: 0.00895161
Score: 0.905
Data Source: STRINGDB
Publication Statistics
PubMed Score  36.23

PubMed score by year
PubTator Score  80.72

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MPSPPGLRALWLCAALCASRRAGGAPQPGPGPTACPAPCHCQEDGIMLSADCSELGLSAVPGDLDPLTAY
1-70
LDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSL
70-140
QSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNRISHIPDYAFQNLT
140-210
SLVVLHLHNNRIQHLGTHSFEGLHNLETLDLNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGN
210-280
PLLQTIHFYDNPIQFVGRSAFQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQ
280-350
LPRLRVLELSHNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRSIHPEAFST
350-420
LHSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAYQCCPYGMCASFFK
420-490
ASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQLEMEDSKPHPSVQCSPTPGPFKPCEYLFE
490-560
SWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPVPLPPVKFVVGAIAGANTLTGISCGLLASVDALTFGQFS
560-630
EYGARWETGLGCRATGFLAVLGSEASVLLLTLAAVQCSVSVSCVRAYGKSPSLGSVRAGVLGCLALAGLA
630-700
AALPLASVGEYGASPLCLPYAPPEGQPAALGFTVALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAVWDCA
700-770
MVRHVAWLIFADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRR
770-840
LRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVTLISCQQPGAP
840-910
RLEGSHCVEPEGNHFGNPQPSMDGELLLRAEGSTPAGGGLSGGGGFQPSGLAFASHV
910-967
MPSPPGLRALWLCAALCASRRAGGAPQPGPGPTACPAPCHCQEDGIMLSADCSELGLSAVPGDLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLDLNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSAFQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLELSHNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRSIHPEAFSTLHSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAYQCCPYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQLEMEDSKPHPSVQCSPTPGPFKPCEYLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPVPLPPVKFVVGAIAGANTLTGISCGLLASVDALTFGQFSEYGARWETGLGCRATGFLAVLGSEASVLLLTLAAVQCSVSVSCVRAYGKSPSLGSVRAGVLGCLALAGLAAALPLASVGEYGASPLCLPYAPPEGQPAALGFTVALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAVWDCAMVRHVAWLIFADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRRLRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVTLISCQQPGAPRLEGSHCVEPEGNHFGNPQPSMDGELLLRAEGSTPAGGGLSGGGGFQPSGLAFASHV