You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LRRC4
Leucine-rich repeat-containing protein 4

Protein Classes
Protein Summary
Description
Synaptic adhesion protein. Regulates the formation of exitatory synapses through the recruitment of pre-and-postsynaptic proteins. Organize the lamina/pathway-specific differentiation of dendrites. Plays a important role for auditory synaptic responses. Involved in the suppression of glioma (By similarity). This gene is significantly downregulated in primary brain tumors. The exact function of the protein encoded by this gene is unknown. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000249363
  • ENSP00000249363
  • ENSG00000128594

Symbol
  • BAG
  • NAG14
  • NGL-2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
gene perturbation
0.61
tissue sample
0.56
kinase perturbation
0.54
PubMedID
0.53


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 28.18   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 94   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 28.18   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 94   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (10)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (56)
1 – 10 of 56
LRRC4C
Tbio
Novelty: 0.00535393
p_int: 0.999997281
p_ni: 0.000002245
p_wrong: 4.74e-7
Score: 0.215
Data Source: BioPlex,STRINGDB
FAM114A2
Tdark
Novelty: 0.75
p_int: 0.999065625
p_ni: 0.000928367
p_wrong: 0.000006008
Score: 0.189
Data Source: BioPlex,STRINGDB
TBCD
Tbio
Novelty: 0.01673453
p_int: 0.99089044
p_ni: 0.00910956
Score: 0.175
Data Source: BioPlex,STRINGDB
XPO4
Tbio
Novelty: 0.02272837
p_int: 0.980036564
p_ni: 0.019963436
Score: 0.159
Data Source: BioPlex,STRINGDB
DPP9
Tchem
Family: Enzyme
Novelty: 0.01345112
p_int: 0.962255505
p_ni: 0.037744474
p_wrong: 2.2e-8
Data Source: BioPlex
CIP2A
Tbio
Novelty: 0.00948462
p_int: 0.923716913
p_ni: 0.076283087
Data Source: BioPlex
POMT2
Tbio
Family: Enzyme
Novelty: 0.03313606
p_int: 0.8662559
p_ni: 0.1337441
Score: 0.177
Data Source: BioPlex,STRINGDB
TNPO2
Tbio
Novelty: 0.07016372
p_int: 0.859192891
p_ni: 0.140807098
p_wrong: 1e-8
Data Source: BioPlex
MID1
Tbio
Family: Enzyme
Novelty: 0.02142845
p_int: 0.846194354
p_ni: 0.00636054
p_wrong: 0.147445106
Score: 0.197
Data Source: BioPlex,STRINGDB
ITGB5
Tbio
Novelty: 0.02400591
p_int: 0.818482661
p_ni: 0.181499167
p_wrong: 0.000018173
Score: 0.181
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  28.18

PubMed score by year
PubTator Score  21.69

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKLLWQVTVHHHTWNAILLPFVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVP
1-70
QGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPS
70-140
GAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKD
140-210
MPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSS
210-280
LPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQC
280-350
SAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTG
350-420
VYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTS
420-490
TTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLRKRHQQRSTV
490-560
TAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPT
560-630
VTTISEPYIIQTHTKDKVQETQI
630-653
MKLLWQVTVHHHTWNAILLPFVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKIIIGCFVAVTLLAAAMLIVFYKLRKRHQQRSTVTAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI