You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SPACA1
Sperm acrosome membrane-associated protein 1

Protein Summary
Description
Plays a role in acrosome expansion and establishment of normal sperm morphology during spermatogenesis (By similarity). Important for male fertility (PubMed:11870081). The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from infertile males. Furthermore, antibodies generated against the recombinant protein block in vitro fertilization. This protein localizes to the acrosomal membrane of spermatids and mature spermatozoa where it is thought to play a role in acrosomal morphogenesis and in sperm-egg binding and fusion, respectively. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000237201
  • ENSP00000237201
  • ENSG00000118434

Symbol
  • SAMP32
  • SAMP32
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.76
cellular component
0.73
gene perturbation
0.56
PubMedID
0.48
tissue
0.48


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.29   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 121   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.29   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 121   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (97)
1 – 10 of 97
KIAA1586
Tdark
Novelty: 5
p_int: 0.999969128
p_ni: 0.000030867
p_wrong: 6e-9
Score: 0.177
Data Source: BioPlex,STRINGDB
DCP2
Tbio
Family: Enzyme
Novelty: 0.00984421
p_int: 0.999648478
p_ni: 0.00035152
p_wrong: 2e-9
Data Source: BioPlex
TATDN2
Tdark
Family: Enzyme
Novelty: 2.76923077
p_int: 0.999060849
p_ni: 0.000655345
p_wrong: 0.000283807
Score: 0.189
Data Source: BioPlex,STRINGDB
VPS13B
Tbio
Novelty: 0.01384539
p_int: 0.998832604
p_ni: 0.001167396
Data Source: BioPlex
TYW1B
Tdark
Family: Enzyme
p_int: 0.994932023
p_ni: 0.004853261
p_wrong: 0.000214716
Data Source: BioPlex
MAP2K7
Tchem
Family: Kinase
Novelty: 0.0002234
p_int: 0.993891135
p_ni: 0.006088535
p_wrong: 0.000020329
Score: 0.191
Data Source: BioPlex,STRINGDB
TRO
Tbio
Novelty: 0.01029039
p_int: 0.992448531
p_ni: 0.007183905
p_wrong: 0.000367564
Data Source: BioPlex
PLD1
Tchem
Family: Enzyme
Novelty: 0.00756297
p_int: 0.991677124
p_ni: 0.008322875
p_wrong: 1e-9
Data Source: BioPlex
DTWD1
Tdark
Novelty: 1.17263844
p_int: 0.990515403
p_ni: 0.005933522
p_wrong: 0.003551076
Score: 0.224
Data Source: BioPlex,STRINGDB
C17orf80
Tdark
Novelty: 0.25531915
p_int: 0.983939162
p_ni: 0.016060838
Score: 0.226
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  7.29

PubMed score by year
PubTator Score  5.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSPRGTGCSAGLLMTVGWLLLAGLQSARGTNVTAAVQDAGLAHEGEGEEETENNDSETAENYAPPETEDV
1-70
SNRNVVKEVEFGMCTVTCGIGVREVILTNGCPGGESKCVVRVEECRGPTDCGWGKPISESLESVRLACIH
70-140
TSPLNRFKYMWKLLRQDQQSIILVNDSAILEVRKESHPLAFECDTLDNNEIVATIKFTVYTSSELQMRRS
140-210
SLPATDAALIFVLTIGVIICVFIIFLLIFIIINWAAVKAFWGAKASTPEVQSEQSSVRYKDSTSLDQLPT
210-280
EMPGEDDALSEWNE
280-294
MSPRGTGCSAGLLMTVGWLLLAGLQSARGTNVTAAVQDAGLAHEGEGEEETENNDSETAENYAPPETEDVSNRNVVKEVEFGMCTVTCGIGVREVILTNGCPGGESKCVVRVEECRGPTDCGWGKPISESLESVRLACIHTSPLNRFKYMWKLLRQDQQSIILVNDSAILEVRKESHPLAFECDTLDNNEIVATIKFTVYTSSELQMRRSSLPATDAALIFVLTIGVIICVFIIFLLIFIIINWAAVKAFWGAKASTPEVQSEQSSVRYKDSTSLDQLPTEMPGEDDALSEWNE