You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
NMUR1
Neuromedin-U receptor 1

Protein Summary
Description
Receptor for the neuromedin-U and neuromedin-S neuropeptides.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000305141
  • ENSP00000305877
  • ENSG00000171596

Symbol
  • GPR66
  • FM3
  • FM-3
  • GPC-R
  • GPR66
  • NMU1R
  • (FM-3)
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.64
microRNA
0.61
protein domain
0.58
cell type or tissue
0.57
gene perturbation
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 116.76   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 194   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 116.76   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 194   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 6
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (10)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (i) signalling events
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Protein-Protein Interactions (357)
1 – 10 of 357
NMU
Tbio
Novelty: 0.00347523
Score: 0.993
Data Source: Reactome,STRINGDB
NMS
Tbio
Novelty: 0.03848674
Score: 0.985
Data Source: STRINGDB
GNRHR
Tclin
Family: GPCR
Novelty: 0.00227536
Score: 0.942
Data Source: STRINGDB
NTS
Tbio
Novelty: 0.00035891
Score: 0.94
Data Source: STRINGDB
NPS
Tbio
Novelty: 0.00011983
Score: 0.928
Data Source: STRINGDB
GNAQ
Tbio
Novelty: 0.00176666
Score: 0.927
Data Source: STRINGDB
POMC
Tbio
Novelty: 0.00002654
Score: 0.927
Data Source: STRINGDB
TBXA2R
Tclin
Family: GPCR
Novelty: 0.00629658
Score: 0.926
Data Source: STRINGDB
GAL
Tbio
Novelty: 0.00057698
Score: 0.925
Data Source: STRINGDB
S1PR4
Tclin
Family: GPCR
Novelty: 0.01383323
Score: 0.924
Data Source: STRINGDB
Publication Statistics
PubMed Score  116.76

PubMed score by year
PubTator Score  55.6

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MTPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMPICATYLLI
1-70
FVVGAVGNGLTCLVILRHKAMRTPTNYYLFSLAVSDLLVLLVGLPLELYEMWHNYPFLLGVGGCYFRTLL
70-140
FEMVCLASVLNVTALSVERYVAVVHPLQARSMVTRAHVRRVLGAVWGLAMLCSLPNTSLHGIRQLHVPCR
140-210
GPVPDSAVCMLVRPRALYNMVVQTTALLFFCLPMAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSR
210-280
YTCRLQQHDRGRRQVTKMLFVLVVVFGICWAPFHADRVMWSVVSQWTDGLHLAFQHVHVISGIFFYLGSA
280-350
ANPVLYSLMSSRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQ
350-420
QETDPS
420-426
MTPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFMPICATYLLIFVVGAVGNGLTCLVILRHKAMRTPTNYYLFSLAVSDLLVLLVGLPLELYEMWHNYPFLLGVGGCYFRTLLFEMVCLASVLNVTALSVERYVAVVHPLQARSMVTRAHVRRVLGAVWGLAMLCSLPNTSLHGIRQLHVPCRGPVPDSAVCMLVRPRALYNMVVQTTALLFFCLPMAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLFVLVVVFGICWAPFHADRVMWSVVSQWTDGLHLAFQHVHVISGIFFYLGSAANPVLYSLMSSRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQQETDPS