You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NTN4
Netrin-4

Protein Summary
Description
May play an important role in neural, kidney and vascular development. Promotes neurite elongation from olfactory bulb explants. This gene encodes a member of the netrin family of proteins, which function in various biological processes including axon guidance, tumorogenesis, and angiogenesis. Netrins are laminin-related proteins that have an N-terminal laminin-type domain, epidermal growth factor-like repeat domain, and a positively charged heparin-binding domain at the C-terminus. The protein encoded by this gene is involved in processes including neurite growth and migration, angiogenesis and mural cell adhesion to endothelial cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000343702
  • ENSP00000340998
  • ENSG00000074527
  • ENST00000344911
  • ENSP00000339436
  • ENST00000538383
  • ENSP00000444432
  • ENST00000553059
  • ENSP00000447292

Symbol
  • PRO3091
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
0.75
transcription factor perturbation
0.74
protein domain
0.73
PubMedID
0.72
histone modification site profile
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 36.72   (req: < 5)
Gene RIFs: 23   (req: <= 3)
Antibodies: 175   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 36.72   (req: >= 5)
Gene RIFs: 23   (req: > 3)
Antibodies: 175   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (9)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Developmental Biology
Reactome
Extracellular matrix organization
Reactome
Netrin-1 signaling
Reactome
Non-integrin membrane-ECM interactions
Name
Explore in Pharos
Explore in Source
Axon guidance
Developmental Biology
Extracellular matrix organization
Netrin-1 signaling
Non-integrin membrane-ECM interactions
Gene Ontology Terms (6)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (32)
1 – 10 of 32
DCC
Tbio
Novelty: 0.00810253
Score: 0.973
Data Source: Reactome,STRINGDB
UNC5A
Tbio
Novelty: 0.05365755
Score: 0.972
Data Source: Reactome,STRINGDB
LAMC1
Tbio
Novelty: 0.01596649
Score: 0.944
Data Source: STRINGDB
LAMC3
Tbio
Novelty: 0.03317215
Score: 0.938
Data Source: STRINGDB
LAMA1
Tbio
Novelty: 0.01015308
Score: 0.938
Data Source: STRINGDB
LAMA3
Tbio
Novelty: 0.0024184
Score: 0.934
Data Source: STRINGDB
LAMA2
Tbio
Novelty: 0.00237711
Score: 0.931
Data Source: STRINGDB
LAMA5
Tbio
Novelty: 0.02842048
Score: 0.931
Data Source: STRINGDB
LAMA4
Tbio
Novelty: 0.02106699
Score: 0.931
Data Source: STRINGDB
LAMB1
Tbio
Novelty: 0.01303566
Score: 0.913
Data Source: STRINGDB
Publication Statistics
PubMed Score  36.72

PubMed score by year
PubTator Score  27.38

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGSCARLLLLWGCTVVAAGLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATELYCFYSENTDL
1-70
TCRQPKCDKCNAAYPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPA
70-140
AMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGAICTSKYSSPFPCTGGEVIFKALSPPYDTENP
140-210
YSAKVQEQLKITNLRVQLLKRQSCPCQRNDLNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPV
210-280
KAPGTFHMVHGKCMCKHNTAGSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEA
280-350
SGNRSGGVCDDCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDC
350-420
PCKPGVAGRRCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCISSHTDIDWYHEVPDFRPVHNKSEPAWE
420-490
WEDAQGFSALLHSGKCECKEQTLGNAKAFCGMKYSYVLKIKILSAHDKGTHVEVNVKIKKVLKSTKLKIF
490-560
RGKRTLYPESWTDRGCTCPILNPGLEYLVAGHEDIRTGKLIVNMKSFVQHWKPSLGRKVMDILKRECK
560-628
MGSCARLLLLWGCTVVAAGLSGVAGVSSRCEKACNPRMGNLALGRKLWADTTCGQNATELYCFYSENTDLTCRQPKCDKCNAAYPHLAHLPSAMADSSFRFPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKYFATNCSATFGLEDDVVKKGAICTSKYSSPFPCTGGEVIFKALSPPYDTENPYSAKVQEQLKITNLRVQLLKRQSCPCQRNDLNEEPQHFTHYAIYDFIVKGSCFCNGHADQCIPVHGFRPVKAPGTFHMVHGKCMCKHNTAGSHCQHCAPLYNDRPWEAADGKTGAPNECRTCKCNGHADTCHFDVNVWEASGNRSGGVCDDCQHNTEGQYCQRCKPGFYRDLRRPFSAPDACKPCSCHPVGSAVLPANSVTFCDPSNGDCPCKPGVAGRRCDRCMVGYWGFGDYGCRPCDCAGSCDPITGDCISSHTDIDWYHEVPDFRPVHNKSEPAWEWEDAQGFSALLHSGKCECKEQTLGNAKAFCGMKYSYVLKIKILSAHDKGTHVEVNVKIKKVLKSTKLKIFRGKRTLYPESWTDRGCTCPILNPGLEYLVAGHEDIRTGKLIVNMKSFVQHWKPSLGRKVMDILKRECK