You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SP110
Sp110 nuclear body protein

Protein Summary
Description
Transcription factor. May be a nuclear hormone receptor coactivator. Enhances transcription of genes with retinoic acid response elements (RARE). The nuclear body is a multiprotein complex that may have a role in the regulation of gene transcription. This gene is a member of the SP100/SP140 family of nuclear body proteins and encodes a leukocyte-specific nuclear body component. The protein can function as an activator of gene transcription and may serve as a nuclear hormone receptor coactivator. In addition, it has been suggested that the protein may play a role in ribosome biogenesis and in the induction of myeloid cell differentiation. Alternative splicing has been observed for this gene and three transcript variants, encoding distinct isoforms, have been identified. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000258381
  • ENSP00000258381
  • ENSG00000135899
  • ENST00000258382
  • ENSP00000258382
  • ENST00000358662
  • ENSP00000351488
  • ENST00000540870
  • ENSP00000439558

Symbol
  • IPR1
  • VODI
  • IFI41
  • IFI75
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
protein domain
0.99
transcription factor perturbation
0.96
disease perturbation
0.83
tissue sample
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.45   (req: < 5)
Gene RIFs: 27   (req: <= 3)
Antibodies: 321   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.45   (req: >= 5)
Gene RIFs: 27   (req: > 3)
Antibodies: 321   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (51)
1 – 10 of 51
STAT1
Tchem
Family: TF
Novelty: 0.00041067
Score: 0.875
Data Source: STRINGDB
SAMD9L
Tbio
Novelty: 0.05426563
Score: 0.776
Data Source: STRINGDB
IFIT3
Tbio
Novelty: 0.00899003
Score: 0.776
Data Source: STRINGDB
MX1
Tbio
Novelty: 0.00081841
Score: 0.761
Data Source: STRINGDB
DDX58
Tbio
Family: Enzyme
Novelty: 0.00108351
Score: 0.756
Data Source: STRINGDB
XAF1
Tbio
Novelty: 0.01614433
Score: 0.739
Data Source: STRINGDB
OAS2
Tbio
Family: Enzyme
Novelty: 0.03283444
Score: 0.732
Data Source: STRINGDB
ISG15
Tbio
Novelty: 0.00256125
Score: 0.699
Data Source: STRINGDB
OAS1
Tbio
Family: Enzyme
Novelty: 0.00774033
Score: 0.692
Data Source: STRINGDB
IFI35
Tbio
Novelty: 0.06821858
Score: 0.687
Data Source: STRINGDB
Publication Statistics
PubMed Score  37.45

PubMed score by year
PubTator Score  87.92

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFTMTRAMEEALFQHFMHQKLGIAYAIHKPFPFFEGLLDNSIITKRMYMESLEACRNLIPVSRVVHNILT
1-70
QLERTFNLSLLVTLFSQINLREYPNLVTIYRSFKRVGASYEWQSRDTPILLEAPTGLAEGSSLHTPLALP
70-140
PPQPPQPSCSPCAPRVSEPGTSSQQSDEILSESPSPSDPVLPLPALIQEGRSTSVTNDKLTSKMNAEEDS
140-210
EEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPEEPQEVSSTPSDKKGKKR
210-280
KRCIWSTPKRRHKKKSLPGGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEE
280-350
IIDGTSEMNEGKRSQKTPSTPRRVTQGAASPGHGIQEKLQVVDKVTQRKDDSTWNSEVMMRVQKARTKCA
350-420
RKSRLKEKKKEKDICSSSKRRFQKNIHRRGKPKSDTVDFHCSKLPVTCGEAKGILYKKKMKHGSSVKCIR
420-490
NEDGTWLTPNEFEVEGKGRNAKNWKRNIRCEGMTLGELLKRKNSDECEVCCQGGQLLCCGTCPRVFHEDC
490-560
HIPPVEAKRMLWSCTFCRMKRSSGSQQCHHVSKTLERQMQPQDQLIRDYGEPFQEAMWLDLVKERLITEM
560-630
YTVAWFVRDMRLMFRNHKTFYKASDFGQVGLDLEAEFEKDLKDVLGFHEANDGGFWTLP
630-689
MFTMTRAMEEALFQHFMHQKLGIAYAIHKPFPFFEGLLDNSIITKRMYMESLEACRNLIPVSRVVHNILTQLERTFNLSLLVTLFSQINLREYPNLVTIYRSFKRVGASYEWQSRDTPILLEAPTGLAEGSSLHTPLALPPPQPPQPSCSPCAPRVSEPGTSSQQSDEILSESPSPSDPVLPLPALIQEGRSTSVTNDKLTSKMNAEEDSEEMPSLLTSTVQVASDNLIPQIRDKEDPQEMPHSPLGSMPEIRDNSPEPNDPEEPQEVSSTPSDKKGKKRKRCIWSTPKRRHKKKSLPGGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTSEMNEGKRSQKTPSTPRRVTQGAASPGHGIQEKLQVVDKVTQRKDDSTWNSEVMMRVQKARTKCARKSRLKEKKKEKDICSSSKRRFQKNIHRRGKPKSDTVDFHCSKLPVTCGEAKGILYKKKMKHGSSVKCIRNEDGTWLTPNEFEVEGKGRNAKNWKRNIRCEGMTLGELLKRKNSDECEVCCQGGQLLCCGTCPRVFHEDCHIPPVEAKRMLWSCTFCRMKRSSGSQQCHHVSKTLERQMQPQDQLIRDYGEPFQEAMWLDLVKERLITEMYTVAWFVRDMRLMFRNHKTFYKASDFGQVGLDLEAEFEKDLKDVLGFHEANDGGFWTLP