You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PLEKHA3
Pleckstrin homology domain-containing family A member 3

Protein Classes
Protein Summary
Description
Involved in Golgi to cell surface membrane traffic. Induces membrane tubulation. Binds preferentially to phosphatidylinositol 4-phosphate (PtdIns4P).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000234453
  • ENSP00000234453
  • ENSG00000116095

Symbol
  • FAPP1
  • FAPP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.8
histone modification site profile
0.75
tissue sample
0.73
transcription factor binding site profile
0.68
gene perturbation
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.48   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 100   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.48   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 100   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (5)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
PI Metabolism
Reactome
Phospholipid metabolism
Reactome
Synthesis of PIPs at the plasma membrane
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of lipids
PI Metabolism
Phospholipid metabolism
Synthesis of PIPs at the plasma membrane
Protein-Protein Interactions (37)
1 – 10 of 37
HAL
Tbio
Family: Enzyme
Novelty: 0.00925623
p_int: 0.999999978
p_wrong: 2.1e-8
Score: 0.325
Data Source: BioPlex,STRINGDB
SEC23B
Tbio
Novelty: 0.0065659
p_int: 0.999374023
p_ni: 0.000613373
p_wrong: 0.000012604
Data Source: BioPlex
ARF1
Tchem
Family: Enzyme
Novelty: 0.00272021
Score: 0.967
Data Source: Reactome,STRINGDB
GLTP
Tbio
Novelty: 0.01208693
Score: 0.816
Data Source: STRINGDB
CEL
Tchem
Family: Enzyme
Novelty: 0.0013569
Score: 0.8
Data Source: STRINGDB
CPLX3
Tbio
Novelty: 0.03411429
Score: 0.75
Data Source: STRINGDB
SACM1L
Tbio
Family: Enzyme
Novelty: 0.00847665
Score: 0.671
Data Source: STRINGDB
MOSPD1
Tdark
Novelty: 0.74468085
Score: 0.67
Data Source: STRINGDB
SERPINA4
Tbio
Novelty: 0.00102012
Score: 0.668
Data Source: STRINGDB
FKBP7
Tbio
Family: Enzyme
Novelty: 0.00592035
Score: 0.647
Data Source: STRINGDB
Publication Statistics
PubMed Score  13.48

PubMed score by year
PubTator Score  9.15

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQH
1-70
FYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHH
70-140
DENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSV
140-210
SHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEE
210-280
SRLMAKKQSESEDTLPSFSS
280-300
MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS