You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SMURF2
E3 ubiquitin-protein ligase SMURF2

Protein Summary
Description
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Interacts with SMAD1 and SMAD7 in order to trigger their ubiquitination and proteasome-dependent degradation. In addition, interaction with SMAD7 activates autocatalytic degradation, which is prevented by interaction with SCYE1. Forms a stable complex with the TGF-beta receptor-mediated phosphorylated SMAD2 and SMAD3. In this way, SMAD2 may recruit substrates, such as SNON, for ubiquitin-mediated degradation. Enhances the inhibitory activity of SMAD7 and reduces the transcriptional activity of SMAD2. Coexpression of SMURF2 with SMAD1 results in considerable decrease in steady-state level of SMAD1 protein and a smaller decrease of SMAD2 level.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000262435
  • ENSP00000262435
  • ENSG00000108854
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
hub protein
0.92
biological process
0.89
interacting protein
0.84
kinase perturbation
0.81
virus perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 84.69   (req: < 5)
Gene RIFs: 55   (req: <= 3)
Antibodies: 291   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 84.69   (req: >= 5)
Gene RIFs: 55   (req: > 3)
Antibodies: 291   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (126)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 29
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen processing: Ubiquitination & Proteasome degradation
Reactome
Asymmetric localization of PCP proteins
Reactome
Beta-catenin independent WNT signaling
Reactome
Class I MHC mediated antigen processing & presentation
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen processing: Ubiquitination & Proteasome degradation
Asymmetric localization of PCP proteins
Beta-catenin independent WNT signaling
Class I MHC mediated antigen processing & presentation
Gene Ontology Terms (29)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (428)
1 – 10 of 428
SMURF1
Tchem
Family: Enzyme
Novelty: 0.00980819
p_int: 1
Score: 0.983
Data Source: BioPlex,STRINGDB
SMAD5
Tbio
Family: TF
Novelty: 0.00607935
p_int: 0.999999913
p_ni: 5.8e-8
p_wrong: 3e-8
Score: 0.982
Data Source: BioPlex,STRINGDB
SMAD1
Tbio
Family: TF
Novelty: 0.0421653
p_int: 0.999999089
p_ni: 9.1e-7
Score: 0.984
Data Source: BioPlex,STRINGDB
SEMG2
Tbio
Novelty: 0.10545717
p_int: 0.999998452
p_ni: 0.000001548
Score: 0.183
Data Source: BioPlex,STRINGDB
MARS2
Tbio
Family: Enzyme
Novelty: 0.03610718
p_int: 0.999989794
p_ni: 0.000010205
p_wrong: 1e-9
Score: 0.201
Data Source: BioPlex,STRINGDB
ARHGAP5
Tbio
Family: Enzyme
Novelty: 0.0530051
p_int: 0.999972752
p_ni: 0.000027248
Score: 0.361
Data Source: BioPlex,STRINGDB
LINGO2
Tbio
Novelty: 0.08773809
p_int: 0.999815954
p_ni: 0.000184046
Score: 0.19
Data Source: BioPlex,STRINGDB
LDLRAD4
Tbio
Novelty: 0.02672907
p_int: 0.998611343
p_ni: 0.001312434
p_wrong: 0.000076223
Score: 0.614
Data Source: BioPlex,STRINGDB
NEDD4
Tchem
Family: Enzyme
Novelty: 0.00341025
p_int: 0.99038598
p_ni: 0.00961402
p_wrong: 1e-9
Score: 0.957
Data Source: BioPlex,STRINGDB
CUEDC1
Tdark
Novelty: 0.26785714
p_int: 0.974652491
p_ni: 0.006209181
p_wrong: 0.019138328
Data Source: BioPlex
Publication Statistics
PubMed Score  84.69

PubMed score by year
PubTator Score  65.12

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYIG
1-70
KSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVRGQIVVSLQSRD
70-140
RIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENT
140-210
PISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWH
210-280
DPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQ
280-350
QVVSLCPDDTECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWK
350-420
RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIM
420-490
GMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAYGEII
490-560
QHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLG
560-630
KIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTI
630-700
HQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEETCGFAVE
700-748
MSNPGGRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPKWNQHYDLYIGKSDSVTISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKLGPNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHITRTTQWERPTRPASEYSSPGRPLSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQVVSLCPDDTECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVNEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKVNTRLKHCTPDSNIVKWFWKAVEFFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEETCGFAVE