You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CHODL
Chondrolectin

Protein Summary
Description
May play a role in the development of the nervous system such as in neurite outgrowth and elongation. May be involved in motor axon growth and guidance. This gene encodes a type I membrane protein with a carbohydrate recognition domain characteristic of C-type lectins in its extracellular portion. In other proteins, this domain is involved in endocytosis of glycoproteins and exogenous sugar-bearing pathogens. This protein localizes predominantly to the perinuclear region. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Feb 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000299295
  • ENSP00000299295
  • ENSG00000154645
  • ENST00000400127
  • ENSP00000382992
  • ENST00000400128
  • ENSP00000382993
  • ENST00000543733
  • ENSP00000443566

Symbol
  • C21orf68
  • MT75
  • PRED12
  • C21orf68
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
phenotype
0.69
gene perturbation
0.65
tissue sample
0.54
transcription factor
0.53
cell line
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 123   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 123   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (7)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (18)
1 – 10 of 18
YBEY
Tdark
Family: Enzyme
Novelty: 0.05001786
Score: 0.745
Data Source: STRINGDB
TMEM41B
Tbio
Novelty: 0.51649928
Score: 0.625
Data Source: STRINGDB
CCDC3
Tbio
Novelty: 0.16632017
Score: 0.564
Data Source: STRINGDB
IGSF5
Tbio
Novelty: 0.16900008
Score: 0.523
Data Source: STRINGDB
HSPB8
Tbio
Novelty: 0.00403809
Score: 0.475
Data Source: STRINGDB
CLDN8
Tbio
Novelty: 0.03010422
Score: 0.472
Data Source: STRINGDB
STAC2
Tdark
Novelty: 0.31171986
Score: 0.462
Data Source: STRINGDB
LCA5L
Tdark
Novelty: 1
Score: 0.46
Data Source: STRINGDB
GPBP1L1
Tdark
Novelty: 0.23809524
Score: 0.447
Data Source: STRINGDB
RABGGTB
Tbio
Family: Enzyme
Novelty: 0.13346044
Score: 0.445
Data Source: STRINGDB
Publication Statistics
PubMed Score  11.00

PubMed score by year
PubTator Score  7.93

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSRVVSLLLGAALLCGHGAFCRRVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLS
1-70
LENEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGDGQTSGACPDLYQWSDGSNSQYRNWYTDEPSCG
70-140
SEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTE
140-210
AGIIPNLIYVVIPTIPLLLLILVAFGTCCFQMLHKSKGRTKTSPNQSTLWISKSTRKESGMEV
210-273
MSRVVSLLLGAALLCGHGAFCRRVVSGQKVCFADFKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLWRNGDGQTSGACPDLYQWSDGSNSQYRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEINPTAPVEKPYLTNQPGDTHQNVVVTEAGIIPNLIYVVIPTIPLLLLILVAFGTCCFQMLHKSKGRTKTSPNQSTLWISKSTRKESGMEV