You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MED20
Mediator of RNA polymerase II transcription subunit 20

Protein Summary
Description
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. This gene encodes a component of the mediator complex (also known as TRAP, SMCC, DRIP, or ARC), a transcriptional coactivator complex thought to be required for the expression of almost all genes. The mediator complex is recruited by transcriptional activators or nuclear receptors to induce gene expression, by interacting with RNA polymerase II and promoting the formation of a transcriptional pre-initiation complex. A mutation in this gene has been associated with a novel infantile-on ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000265350
  • ENSP00000265350
  • ENSG00000124641
  • ENST00000409312
  • ENSP00000386816

Symbol
  • TRFP
  • SRB2
  • TRFP
  • PRO0213
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.95
transcription factor binding site profile
0.84
histone modification site profile
0.81
transcription factor perturbation
0.61
kinase perturbation
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 31.26   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 89   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 31.26   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 89   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (9)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Metabolism
Reactome
Metabolism of lipids
Name
Explore in Pharos
Explore in Source
Developmental Biology
Gene expression (Transcription)
Generic Transcription Pathway
Metabolism
Metabolism of lipids
Protein-Protein Interactions (89)
1 – 10 of 89
MED18
Tbio
Family: Enzyme
Novelty: 0.00819084
p_int: 0.999999926
p_ni: 7.4e-8
Score: 0.999
Data Source: BioPlex,STRINGDB
MED6
Tbio
Family: Enzyme
Novelty: 0.07496272
p_int: 0.999999708
p_ni: 2.9e-7
p_wrong: 2e-9
Score: 0.994
Data Source: BioPlex,STRINGDB
MED27
Tbio
Family: Enzyme
Novelty: 0.02999536
p_int: 0.999999605
p_ni: 3.95e-7
Score: 0.996
Data Source: BioPlex,STRINGDB
MED26
Tbio
Family: Enzyme
Novelty: 0.07213908
p_int: 0.999999525
p_ni: 4.75e-7
Score: 0.955
Data Source: BioPlex,STRINGDB
MED17
Tbio
Family: Enzyme
Novelty: 0.02150905
p_int: 0.999999516
p_ni: 4.84e-7
p_wrong: 1e-9
Score: 0.998
Data Source: BioPlex,STRINGDB
MED19
Tbio
Family: Enzyme
Novelty: 0.0129406
p_int: 0.999999305
p_ni: 6.96e-7
Score: 0.995
Data Source: BioPlex,STRINGDB
MED24
Tbio
Family: Enzyme
Novelty: 0.06494678
p_int: 0.999998891
p_ni: 0.00000111
Score: 0.992
Data Source: BioPlex,STRINGDB
MED14
Tbio
Family: Enzyme
Novelty: 0.02274389
p_int: 0.999998835
p_ni: 0.000001165
Score: 0.996
Data Source: BioPlex,STRINGDB
MED31
Tbio
Family: Enzyme
Novelty: 0.0541425
p_int: 0.999998675
p_ni: 8.74e-7
p_wrong: 4.51e-7
Score: 0.967
Data Source: BioPlex,STRINGDB
MED13L
Tbio
Family: Enzyme
Novelty: 0.04826424
p_int: 0.999998208
p_ni: 0.000001792
Score: 0.919
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  31.26

PubMed score by year
PubTator Score  12.48

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSE
1-70
YPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISV
70-140
EVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAG
140-210
IR
210-212
MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAGIR