You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TMEM206
Transmembrane protein 206

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000261455
  • ENSP00000261455
  • ENSG00000065600
  • ENST00000535273
  • ENSP00000438863

Symbol
  • C1orf75
  • C1orf75
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.98
kinase perturbation
0.84
histone modification site profile
0.8
tissue sample
0.67
transcription factor binding site profile
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.6   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 28   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.6   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 28   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (2)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (88)
1 – 10 of 88
TMEM147
Tdark
Novelty: 0.71342926
p_int: 0.999998412
p_ni: 0.000001525
p_wrong: 6.2e-8
Score: 0.181
Data Source: BioPlex,STRINGDB
NOP9
Tdark
p_int: 0.999948695
p_ni: 0.000051304
p_wrong: 1e-9
Data Source: BioPlex
DCUN1D5
Tdark
Novelty: 0.5
p_int: 0.999935065
p_ni: 0.000052423
p_wrong: 0.000012512
Data Source: BioPlex
KNTC1
Tbio
Novelty: 0.00267098
p_int: 0.999816781
p_ni: 0.000183219
Data Source: BioPlex
WDR3
Tbio
Novelty: 0.18709843
p_int: 0.999639804
p_ni: 0.000360196
Data Source: BioPlex
GNPAT
Tchem
Family: Enzyme
Novelty: 0.0152005
p_int: 0.999548841
p_ni: 0.000451159
Data Source: BioPlex
THADA
Tbio
Novelty: 0.02734274
p_int: 0.999518696
p_ni: 0.000481304
Data Source: BioPlex
ZWILCH
Tbio
Novelty: 0.072
p_int: 0.999389086
p_ni: 0.000610914
Data Source: BioPlex
PI4K2A
Tbio
Family: Kinase
Novelty: 0.00759288
p_int: 0.999363506
p_ni: 0.000636493
p_wrong: 1e-9
Data Source: BioPlex
PBXIP1
Tbio
Novelty: 0.15158351
p_int: 0.999346796
p_ni: 0.000653204
Data Source: BioPlex
Publication Statistics
PubMed Score  0.60

PubMed score by year
PubTator Score  0.14

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MIRQERSTSYQELSEELVQVVENSELADEQDKETVRVQGPGILPGLDSESASSSIRFSKACLKNVFSVLL
1-70
IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYPGQAQLLSCKHHYEVIPPLTS
70-140
PGQPGDMNCTTQRINYTDPFSNQTVKSALIVQGPREVKKRELVFLQFRLNKSSEDFSAIDYLLFSSFQEF
140-210
LQSPNRVGFMQACESAYSSWKFSGGFRTWVKMSLVKTKEEDGREAVEFRQETSVVNYIDQRPAAKKSAQL
210-280
FFVVFEWKDPFIQKVQDIVTANPWNTIALLCGAFLALFKAAEFAKLSIKWMIKIRKRYLKRRGQATSHIS
280-350
MIRQERSTSYQELSEELVQVVENSELADEQDKETVRVQGPGILPGLDSESASSSIRFSKACLKNVFSVLLIFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYPGQAQLLSCKHHYEVIPPLTSPGQPGDMNCTTQRINYTDPFSNQTVKSALIVQGPREVKKRELVFLQFRLNKSSEDFSAIDYLLFSSFQEFLQSPNRVGFMQACESAYSSWKFSGGFRTWVKMSLVKTKEEDGREAVEFRQETSVVNYIDQRPAAKKSAQLFFVVFEWKDPFIQKVQDIVTANPWNTIALLCGAFLALFKAAEFAKLSIKWMIKIRKRYLKRRGQATSHIS