You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
VSIR
V-type immunoglobulin domain-containing suppressor of T-cell activation

Protein Summary
Description
Immunoregulatory receptor which inhibits the T-cell response (PubMed:24691993). May promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling (By similarity). May stimulate MMP14-mediated MMP2 activation (PubMed:20666777).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000394957
  • ENSP00000378409
  • ENSG00000107738

Symbol
  • C10orf54
  • SISP1
  • VISTA
  • B7H5
  • GI24
  • B7-H5
  • Dies1
  • PD-1H
  • SISP1
  • VISTA
  • PP2135
  • C10orf54
  • DD1alpha
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 384.29   (req: < 5)
Gene RIFs: 13   (req: <= 3)
Antibodies: 293   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 384.29   (req: >= 5)
Gene RIFs: 13   (req: > 3)
Antibodies: 293   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (24)
1 – 10 of 24
PITPNA
Tbio
Novelty: 0.02020332
Score: 0.624
Data Source: STRINGDB
HAVCR2
Tbio
Novelty: 0.00217571
Score: 0.596
Data Source: STRINGDB
LAG3
Tbio
Novelty: 0.00267873
Score: 0.591
Data Source: STRINGDB
BTLA
Tbio
Novelty: 0.01059679
Score: 0.58
Data Source: STRINGDB
FOXP3
Tbio
Family: TF
Novelty: 0.00020363
Score: 0.569
Data Source: STRINGDB
TRAF1
Tbio
Novelty: 0.00703177
Score: 0.556
Data Source: STRINGDB
CD274
Tclin
Novelty: 0.00020953
Score: 0.554
Data Source: STRINGDB
TIGIT
Tbio
Novelty: 0.01223861
Score: 0.533
Data Source: STRINGDB
VTCN1
Tbio
Novelty: 0.00614002
Score: 0.518
Data Source: STRINGDB
CTLA4
Tclin
Novelty: 0.00017405
Score: 0.516
Data Source: STRINGDB
Publication Statistics
PubMed Score  384.29

PubMed score by year
PubTator Score  104.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYK
1-70
TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLD
70-140
SGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPL
140-210
ILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLS
210-280
EPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI
280-311
MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAAALATGACIVGILCLPLILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLSEPSTPLSPPGPGDVFFPSLDPVPDSPNFEVI