You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
AZI2
5-azacytidine-induced protein 2

Protein Summary
Description
Adapter protein which binds TBK1 and IKBKE playing a role in antiviral innate immunity. Activates serine/threonine-protein kinase TBK1 and facilitates its oligomerization. Enhances the phosphorylation of NF-kappa-B p65 subunit RELA by TBK1. Promotes TBK1-induced as well as TNF-alpha or PMA-induced activation of NF-kappa-B. Participates in IFNB promoter activation via TICAM1. AZI2, or NAP1, contributes to the activation of NFKB (see MIM 164011)-dependent gene expression by activating IKK-related kinases, such as NAK (TBK1; MIM 604834) (Fujita et al., 2003 [PubMed 14560022]).[supplied by OMIM, Mar 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000334100
  • ENSP00000335609
  • ENSG00000163512
  • ENST00000420543
  • ENSP00000391696
  • ENST00000457172
  • ENSP00000389577
  • ENST00000479665
  • ENSP00000419371

Symbol
  • NAP1
  • TBKBP2
  • AZ2
  • NAP1
  • TILP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug perturbation
1
virus perturbation
1
transcription factor binding site profile
0.91
kinase perturbation
0.84
interacting protein
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.54   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 109   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.54   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 109   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (11)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (32)
1 – 10 of 32
BBOX1
Tchem
Family: Enzyme
Novelty: 0.00263045
p_int: 0.999999707
p_ni: 2.93e-7
Score: 0.237
Data Source: BioPlex,STRINGDB
APBA3
Tbio
Novelty: 0.06087545
p_int: 0.999999434
p_ni: 5.64e-7
p_wrong: 2e-9
Score: 0.189
Data Source: BioPlex,STRINGDB
CALCOCO2
Tbio
Novelty: 0.00398884
p_int: 0.999998792
p_ni: 3.2e-8
p_wrong: 0.000001176
Score: 0.706
Data Source: BioPlex,STRINGDB
PIP
Tbio
Novelty: 0.00268794
p_int: 0.999998601
p_ni: 0.000001398
Data Source: BioPlex
IRAK3
Tchem
Family: Kinase
Novelty: 0.01432197
p_int: 0.987415372
p_ni: 0.000576863
p_wrong: 0.012007764
Score: 0.189
Data Source: BioPlex,STRINGDB
TBK1
Tchem
Family: Kinase
Novelty: 0.00150228
Score: 0.999
Data Source: STRINGDB
IKBKE
Tchem
Family: Kinase
Novelty: 0.01836892
Score: 0.945
Data Source: STRINGDB
TANK
Tbio
Novelty: 0.01379942
Score: 0.906
Data Source: STRINGDB
TBKBP1
Tbio
Family: Enzyme
Novelty: 0.18771585
Score: 0.901
Data Source: STRINGDB
IKBKG
Tbio
Family: Kinase
Novelty: 0.00081998
Score: 0.85
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.54

PubMed score by year
PubTator Score  7.54

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENSLLKKRIRFLE
1-70
EKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSESLKVLNEQLQSKEVELLQLRT
70-140
EVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQ
140-210
KLSISSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSTAIKKACAPVGCSEDLGRDSTKLHLMNFTA
210-280
TYTRHPPLLPNGKALCHTTSSPLPGDVKVLSEKAILQSWTDNERSIPNDGTCFQEHSSYGRNSLEDNSWV
280-350
FPSPPKSSETAFGETKTKTLPLPNLPPLHYLDQHNQNCLYKN
350-392
MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENSLLKKRIRFLEEKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSESLKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMRKECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNMQHAYWELKREMSNLHLVTQVQAELLRKLKTSTAIKKACAPVGCSEDLGRDSTKLHLMNFTATYTRHPPLLPNGKALCHTTSSPLPGDVKVLSEKAILQSWTDNERSIPNDGTCFQEHSSYGRNSLEDNSWVFPSPPKSSETAFGETKTKTLPLPNLPPLHYLDQHNQNCLYKN