You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CLMP
CXADR-like membrane protein

Protein Summary
Description
May be involved in the cell-cell adhesion. May play a role in adipocyte differentiation and development of obesity. Is required for normal small intestine development. This gene encodes a type I transmembrane protein that is localized to junctional complexes between endothelial and epithelial cells and may have a role in cell-cell adhesion. Expression of this gene in white adipose tissue is implicated in adipocyte maturation and development of obesity. This gene is also essential for normal intestinal development and mutations in the gene are associated with congenital short bowel syndrome. [provided by RefSeq, Aug 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000448775
  • ENSP00000405577
  • ENSG00000166250

Symbol
  • ACAM
  • ASAM
  • ACAM
  • ASAM
  • CSBM
  • CSBS
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.73
PubMedID
0.69
cellular component
0.59
small molecule perturbation
0.56
histone modification site profile
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 221.42   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 153   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 221.42   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 153   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (33)
1 – 10 of 33
KIF14
Tbio
Novelty: 0.02907785
p_int: 0.998982142
p_ni: 0.001017858
Data Source: BioPlex
IP6K1
Tbio
Family: Kinase
Novelty: 0.02925139
p_int: 0.998257197
p_ni: 0.001742756
p_wrong: 4.7e-8
Score: 0.228
Data Source: BioPlex,STRINGDB
UTP20
Tbio
Novelty: 0.03742259
p_int: 0.995119163
p_ni: 0.004880837
Score: 0.239
Data Source: BioPlex,STRINGDB
KIDINS220
Tbio
Family: Enzyme
Novelty: 0.00070004
p_int: 0.932744357
p_ni: 0.067255643
Data Source: BioPlex
RRP1
Tbio
Novelty: 0.19007392
p_int: 0.816949616
p_ni: 0.183050291
p_wrong: 9.3e-8
Score: 0.189
Data Source: BioPlex,STRINGDB
MLST8
Tbio
Novelty: 0.00212271
p_int: 0.755298111
p_ni: 0.244701882
p_wrong: 7e-9
Score: 0.226
Data Source: BioPlex,STRINGDB
TFPI
Tchem
Novelty: 0.0007551
Score: 0.758
Data Source: STRINGDB
CDH1
Tbio
Novelty: 0.0001303
Score: 0.703
Data Source: STRINGDB
OGG1
Tbio
Family: Enzyme
Novelty: 0.00054356
Score: 0.63
Data Source: STRINGDB
ERCC6
Tbio
Novelty: 0.00160594
Score: 0.623
Data Source: STRINGDB
Publication Statistics
PubMed Score  221.42

PubMed score by year
PubTator Score  74.72

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSLLLLLLLVSYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRH
1-70
VYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELE
70-140
GELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTA
140-210
GNEAGKESCVVRVTVQYVQSIGMVAGAVTGIVAGALLIFLLVWLLIRRKDKERYEEEERPNEIREDAEAP
210-280
KARLVKPSSSSSGSRSSRSGSSSTRSTANSASRSQRTLSTDAAPQPGLATQAYSLVGPEVRGSEPKKVHH
280-350
ANLTKAETTPSMIPSQSRAFQTV
350-373
MSLLLLLLLVSYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCVVRVTVQYVQSIGMVAGAVTGIVAGALLIFLLVWLLIRRKDKERYEEEERPNEIREDAEAPKARLVKPSSSSSGSRSSRSGSSSTRSTANSASRSQRTLSTDAAPQPGLATQAYSLVGPEVRGSEPKKVHHANLTKAETTPSMIPSQSRAFQTV