You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SENP3
Sentrin-specific protease 3

Protein Classes
Protein Summary
Description
Protease that releases SUMO2 and SUMO3 monomers from sumoylated substrates, but has only weak activity against SUMO1 conjugates. Deconjugates SUMO2 from MEF2D, which increases its transcriptional activation capability. Deconjugates SUMO2 and SUMO3 from CDCA8. Redox sensor that, when redistributed into nucleoplasm, can act as an effector to enhance HIF1A transcriptional activity by desumoylating EP300. Required for rRNA processing through deconjugation of SUMO2 and SUMO3 from nucleophosmin, NPM1. Plays a role in the regulation of sumoylation status of ZNF148. Functions as a component of the Five Friends of Methylated CHTOP (5FMC) complex; the 5FMC complex is recruited to ZNF148 by methylated CHTOP, leading to desumoylation of ZNF148 and subsequent transactivation of ZNF148 target genes. The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1; MIM 601912) is required for numerous biologic processes. SUMO-specific protease ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000321337
  • ENSP00000314029
  • ENSG00000161956
  • ENST00000429205
  • ENSP00000403712

Symbol
  • SSP3
  • SUSP3
  • SSP3
  • Ulp1
  • SMT3IP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.99
kinase perturbation
0.97
transcription factor binding site profile
0.8
cellular component
0.79
cell type or tissue
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 97.26   (req: < 5)
Gene RIFs: 27   (req: <= 3)
Antibodies: 224   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 97.26   (req: >= 5)
Gene RIFs: 27   (req: > 3)
Antibodies: 224   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Major pathway of rRNA processing in the nucleolus and cytosol (R-HSA-6791226)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Major pathway of rRNA processing in the nucleolus and cytosol
Reactome
Metabolism of RNA
Reactome
rRNA processing
Reactome
rRNA processing in the nucleus and cytosol
Name
Explore in Pharos
Explore in Source
Major pathway of rRNA processing in the nucleolus and cytosol
Metabolism of RNA
rRNA processing
rRNA processing in the nucleus and cytosol
Gene Ontology Terms (8)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (231)
1 – 10 of 231
NOL9
Tdark
Family: Enzyme
Novelty: 0.06213937
p_int: 0.999614669
p_ni: 0.000385331
Score: 0.979
Data Source: BioPlex,STRINGDB
WDR18
Tbio
Novelty: 0.01710887
p_int: 0.999500332
p_ni: 0.000499668
Score: 0.998
Data Source: BioPlex,STRINGDB
PHF19
Tbio
Family: Epigenetic
Novelty: 0.01635323
p_int: 0.900722242
p_ni: 0.099277758
Score: 0.242
Data Source: BioPlex,STRINGDB
P4HA1
Tchem
Family: Enzyme
Novelty: 0.02187424
p_int: 0.876797832
p_ni: 0.123202168
Data Source: BioPlex
H2AFB1
Tbio
Novelty: 0.11469143
p_int: 0.871748939
p_ni: 0.128250759
p_wrong: 3.02e-7
Data Source: BioPlex
TNFRSF13B
Tbio
Novelty: 0.00443808
p_int: 0.799975362
p_ni: 0.200024638
Score: 0.189
Data Source: BioPlex,STRINGDB
TEX10
Tdark
Novelty: 0.18399411
Score: 0.998
Data Source: STRINGDB
PELP1
Tbio
Novelty: 0.01530484
Score: 0.994
Data Source: STRINGDB
LAS1L
Tdark
Novelty: 0.27897708
Score: 0.981
Data Source: STRINGDB
RPL37A
Tbio
Novelty: 0.03125092
Score: 0.976
Data Source: STRINGDB
Publication Statistics
PubMed Score  97.26

PubMed score by year
PubTator Score  39.36

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKETIQGTGSWGPEPPGPGIPPAYSSPRRERLRWPPPPKPRLKSGGGFGPDPGSGTTVPARRLPVPRPSF
1-70
DASASEEEEEEEEEEDEDEEEEVAAWRLPPRWSQLGTSQRPRPSRPTHRKTCSQRRRRAMRAFRMLLYSK
70-140
STSLTFHWKLWGRHRGRRRGLAHPKNHLSPQQGGATPQVPSPCCRFDSPRGPPPPRLGLLGALMAEDGVR
140-210
GSPPVPSGPPMEEDGLRWTPKSPLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGDHV
210-280
AQELFQGSDLGMAEEAERPGEKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQE
280-350
FSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPE
350-420
KVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRR
420-490
CPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLR
490-560
RQIYKELCHCKLTV
560-574
MKETIQGTGSWGPEPPGPGIPPAYSSPRRERLRWPPPPKPRLKSGGGFGPDPGSGTTVPARRLPVPRPSFDASASEEEEEEEEEEDEDEEEEVAAWRLPPRWSQLGTSQRPRPSRPTHRKTCSQRRRRAMRAFRMLLYSKSTSLTFHWKLWGRHRGRRRGLAHPKNHLSPQQGGATPQVPSPCCRFDSPRGPPPPRLGLLGALMAEDGVRGSPPVPSGPPMEEDGLRWTPKSPLDPDSGLLSCTLPNGFGGQSGPEGERSLAPPDASILISNVCSIGDHVAQELFQGSDLGMAEEAERPGEKAGQHSPLREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTLYGQNWLNDQVMNMYGDLVMDTVPEKVHFFNSFFYDKLRTKGYDGVKRWTKNVDIFNKELLLIPIHLEVHWSLISVDVRRRTITYFDSQRTLNRRCPKHIAKYLQAEAVKKDRLDFHQGWKGYFKMNVARQNNDSDCGAFVLQYCKHLALSQPFSFTQQDMPKLRRQIYKELCHCKLTV