You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GOLPH3
Golgi phosphoprotein 3

Protein Summary
Description
Phosphatidylinositol-4-phosphate-binding protein that links Golgi membranes to the cytoskeleton and may participate in the tensile force required for vesicle budding from the Golgi. Thereby, may play a role in Golgi membrane trafficking and could indirectly give its flattened shape to the Golgi apparatus. May also bind to the coatomer to regulate Golgi membrane trafficking. May play a role in anterograde transport from the Golgi to the plasma membrane and regulate secretion. Has also been involved in the control of the localization of Golgi enzymes through interaction with their cytoplasmic part. May play an indirect role in cell migration. Has also been involved in the modulation of mTOR signaling. May also be involved in the regulation of mitochondrial lipids biosynthesis. The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a peripheral membrane protein of the Golgi stack and may h ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000265070
  • ENSP00000265070
  • ENSG00000113384

Symbol
  • GPP34
  • GOPP1
  • GPP34
  • MIDAS
  • Vps74
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.86
interacting protein
0.86
transcription factor binding site profile
0.86
disease perturbation
0.83
tissue sample
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4624.67   (req: < 5)
Gene RIFs: 68   (req: <= 3)
Antibodies: 242   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4624.67   (req: >= 5)
Gene RIFs: 68   (req: > 3)
Antibodies: 242   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (31)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (230)
1 – 10 of 230
PNKD
Tbio
Family: Enzyme
Novelty: 0.01082297
p_int: 0.999991773
p_ni: 0.000008227
Data Source: BioPlex
SSBP1
Tbio
Novelty: 0.01538144
p_int: 0.999755028
p_ni: 0.000244922
p_wrong: 5.1e-8
Data Source: BioPlex
RASSF8
Tbio
Novelty: 0.08828757
p_int: 0.999671046
p_ni: 0.000328374
p_wrong: 5.8e-7
Data Source: BioPlex
IMPAD1
Tbio
Family: Enzyme
Novelty: 0.08888889
p_int: 0.998839414
p_ni: 0.001146921
p_wrong: 0.000013666
Data Source: BioPlex
RCC1L
Tbio
Novelty: 0.05024524
p_int: 0.99846645
p_ni: 0.00153355
Score: 0.53
Data Source: BioPlex,STRINGDB
ST3GAL1
Tchem
Family: Enzyme
Novelty: 0.01354262
p_int: 0.997501922
p_ni: 0.002495983
p_wrong: 0.000002094
Score: 0.251
Data Source: BioPlex,STRINGDB
AMIGO3
Tdark
Novelty: 2.4
p_int: 0.996563632
p_ni: 0.003436326
p_wrong: 4.1e-8
Data Source: BioPlex
GPRC5C
Tdark
Family: GPCR
Novelty: 0.19417476
p_int: 0.995890483
p_ni: 0.004108252
p_wrong: 0.000001265
Data Source: BioPlex
GMPPA
Tbio
Family: Enzyme
Novelty: 0.02186598
p_int: 0.995757653
p_ni: 0.004242347
Score: 0.865
Data Source: BioPlex,STRINGDB
C5AR2
Tbio
Family: GPCR
Novelty: 0.01354267
p_int: 0.995045935
p_ni: 0.004954035
p_wrong: 3e-8
Data Source: BioPlex
Publication Statistics
PubMed Score  4624.67

PubMed score by year
PubTator Score  529.27

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLG
1-70
LKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHV
70-140
KETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIK
140-210
QRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVEC
210-280
LKANTNEVLWAVVAAFTK
280-298
MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK