You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SRMS
Tyrosine-protein kinase Srms

Protein Summary
Description
Non-receptor tyrosine-protein kinase which phosphorylates DOK1 on tyrosine residues (PubMed:23822091). Also phosphorylates KHDRBS1/SAM68 and VIM on tyrosine residues (PubMed:29496907). Phosphorylation of KHDRBS1 is EGF-dependent (PubMed:29496907).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000217188
  • ENSP00000217188
  • ENSG00000125508

Symbol
  • C20orf148
  • SRM
  • PTK70
  • C20orf148
  • dJ697K14.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.97
molecular function
0.94
tissue
0.66
cell type or tissue
0.63
PubMedID
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 26.92   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 173   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 26.92   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 173   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
dasatinib
chemical structure image
Pathways (100)
PTK6 Down-Regulation (R-HSA-8849472)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
PTK6 Down-Regulation
Reactome
Signal Transduction
Reactome
Signaling by Non-Receptor Tyrosine Kinases
Reactome
Signaling by PTK6
Name
Explore in Pharos
Explore in Source
PTK6 Down-Regulation
Signal Transduction
Signaling by Non-Receptor Tyrosine Kinases
Signaling by PTK6
Protein-Protein Interactions (24)
1 – 10 of 24
PTK6
Tchem
Family: Kinase
Novelty: 0.0060225
Score: 0.91
Data Source: Reactome,STRINGDB
STK31
Tchem
Family: Kinase
Novelty: 0.14690451
Score: 0.686
Data Source: STRINGDB
TBRG4
Tbio
Novelty: 0.0393341
Score: 0.676
Data Source: STRINGDB
DOK1
Tbio
Novelty: 0.02119931
Score: 0.596
Data Source: STRINGDB
SNX8
Tbio
Novelty: 0.04101729
Score: 0.59
Data Source: STRINGDB
KIFC3
Tbio
Novelty: 0.07290351
Score: 0.587
Data Source: STRINGDB
SMCHD1
Tbio
Novelty: 0.00627532
Score: 0.552
Data Source: STRINGDB
ZNF568
Tdark
Family: TF
Novelty: 0.33136095
Score: 0.524
Data Source: STRINGDB
GMEB2
Tdark
Family: TF
Novelty: 0.2732596
Score: 0.523
Data Source: STRINGDB
FAM102A
Tdark
Novelty: 0.46545992
Score: 0.519
Data Source: STRINGDB
Publication Statistics
PubMed Score  26.92

PubMed score by year
PubTator Score  3.3

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEPFLRRRLAFLSFFWDKIWPAGGEPDHGTPGSLDPNTDPVPTLPAEPCSPFPQLFLALYDFTARCGGEL
1-70
SVRRGDRLCALEEGGGYIFARRLSGQPSAGLVPITHVAKASPETLSDQPWYFSGVSRTQAQQLLLSPPNE
70-140
PGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLYLQKGRLFPGLEELLTYYKANWKLIQNPLLQ
140-210
PCMPQKAPRQDVWERPHSEFALGRKLGEGYFGEVWEGLWLGSLPVAIKVIKSANMKLTDLAKEIQTLKGL
210-280
RHERLIRLHAVCSGGEPVYIVTELMRKGNLQAFLGTPEGRALRLPPLLGFACQVAEGMSYLEEQRVVHRD
280-350
LAARNVLVDDGLACKVADFGLARLLKDDIYSPSSSSKIPVKWTAPEAANYRVFSQKSDVWSFGVLLHEVF
350-420
TYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRCHP
420-488
MEPFLRRRLAFLSFFWDKIWPAGGEPDHGTPGSLDPNTDPVPTLPAEPCSPFPQLFLALYDFTARCGGELSVRRGDRLCALEEGGGYIFARRLSGQPSAGLVPITHVAKASPETLSDQPWYFSGVSRTQAQQLLLSPPNEPGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLYLQKGRLFPGLEELLTYYKANWKLIQNPLLQPCMPQKAPRQDVWERPHSEFALGRKLGEGYFGEVWEGLWLGSLPVAIKVIKSANMKLTDLAKEIQTLKGLRHERLIRLHAVCSGGEPVYIVTELMRKGNLQAFLGTPEGRALRLPPLLGFACQVAEGMSYLEEQRVVHRDLAARNVLVDDGLACKVADFGLARLLKDDIYSPSSSSKIPVKWTAPEAANYRVFSQKSDVWSFGVLLHEVFTYGQCPYEGMTNHETLQQIMRGYRLPRPAACPAEVYVLMLECWRSSPEERPSFATLREKLHAIHRCHP