You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
KCNN2
Small conductance calcium-activated potassium channel protein 2

Protein Summary
Description
Forms a voltage-independent potassium channel activated by intracellular calcium. Activation is followed by membrane hyperpolarization. Thought to regulate neuronal excitability by contributing to the slow component of synaptic afterhyperpolarization. The channel is blocked by apamin. Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by this gene is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. This gene is a member of the KCNN family of potassium channel genes. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000264773
  • ENSP00000264773
  • ENSG00000080709
  • ENST00000503706
  • ENSP00000421439
  • ENST00000610748
  • ENSP00000483124

Symbol
  • SK2
  • hSK2
  • SKCA2
  • KCa2.2
  • SKCa 2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.94
transcription factor
0.77
histone modification site profile
0.74
ligand (chemical)
0.7
tissue sample
0.7


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.14   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 106   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.14   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 106   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 25
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (62)
Ca2+ activated K+ channels (R-HSA-1296052)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Ca2+ activated K+ channels
Reactome
Neuronal System
Reactome
Potassium Channels
Name
Explore in Pharos
Explore in Source
Ca2+ activated K+ channels
Neuronal System
Potassium Channels
Gene Ontology Terms (17)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (58)
1 – 10 of 58
CALM1
Tclin
Novelty: 0.00331843
Score: 0.987
Data Source: STRINGDB
CALM3
Tclin
Novelty: 0.0082907
Score: 0.985
Data Source: STRINGDB
CALM2
Tclin
Novelty: 0.02810502
Score: 0.97
Data Source: STRINGDB
KCNMA1
Tclin
Family: IC
Novelty: 0.00067067
Score: 0.947
Data Source: STRINGDB
KCNMB4
Tbio
Family: IC
Novelty: 0.09644792
Score: 0.925
Data Source: STRINGDB
KCNU1
Tbio
Family: IC
Novelty: 0.01936198
Score: 0.903
Data Source: STRINGDB
KCND2
Tclin
Family: IC
Novelty: 0.00380702
Score: 0.896
Data Source: STRINGDB
KCNMB1
Tbio
Family: IC
Novelty: 0.01165598
Score: 0.876
Data Source: STRINGDB
KCNN4
Tchem
Family: IC
Novelty: 0.00319428
Score: 0.813
Data Source: STRINGDB
KCNMB3
Tbio
Family: IC
Novelty: 0.18426318
Score: 0.812
Data Source: STRINGDB
Publication Statistics
PubMed Score  22.14

PubMed score by year
PubTator Score  67.94

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPASVGGGGGASSPSAAAAAAAAVSSSAPEIVVSK
1-70
PEHNNSNNLALYGTGGGGSTGGGGGGGGSGHGSSSGTKSSKKKNQNIGYKLGHRRALFEKRKRLSDYALI
70-140
FGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMT
140-210
YERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLF
210-280
TDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMW
280-350
LISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVK
350-420
NAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMY
420-490
DMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQRDFIEAQMESYDKHVTYNAERSRS
490-560
SSRRRRSSSTAPPTSSESS
560-579
MSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPASVGGGGGASSPSAAAAAAAAVSSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGGGSGHGSSSGTKSSKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTIRQQQRDFIEAQMESYDKHVTYNAERSRSSSRRRRSSSTAPPTSSESS