You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ALX4
Homeobox protein aristaless-like 4

Protein Summary
Description
Transcription factor involved in skull and limb development. Plays an essential role in craniofacial development, skin and hair follicle development. This gene encodes a paired-like homeodomain transcription factor expressed in the mesenchyme of developing bones, limbs, hair, teeth, and mammary tissue. Mutations in this gene cause parietal foramina 2 (PFM2); an autosomal dominant disease characterized by deficient ossification of the parietal bones. Mutations in this gene also cause a form of frontonasal dysplasia with alopecia and hypogonadism; suggesting a role for this gene in craniofacial development, mesenchymal-epithelial communication, and hair follicle development. Deletion of a segment of chromosome 11 containing this gene, del(11)(p11p12), causes Potocki-Shaffer syndrome (PSS); a syndrome characterized by craniofacial anomalies, cognitive disability, multiple exostoses, and genital abnormalities in males. In mouse, this gene has been shown to use dual translation initiation s ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000329255
  • ENSP00000332744
  • ENSG00000052850

Symbol
  • KIAA1788
  • CRS5
  • FND2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.74
microRNA
0.66
phenotype
0.64
trait
0.61
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 56.43   (req: < 5)
Gene RIFs: 19   (req: <= 3)
Antibodies: 265   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 56.43   (req: >= 5)
Gene RIFs: 19   (req: > 3)
Antibodies: 265   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (20)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Sequence Alignment (ISA)
NTNU_SB
Non-traceable Author Statement (NAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (86)
1 – 10 of 86
GLI3
Tbio
Family: TF
Novelty: 0.00059889
Score: 0.689
Data Source: STRINGDB
TBX18
Tbio
Family: TF
Novelty: 0.01534395
Score: 0.65
Data Source: STRINGDB
LEF1
Tchem
Family: TF
Novelty: 0.00223818
Score: 0.648
Data Source: STRINGDB
HOXD13
Tbio
Family: TF
Novelty: 0.00497439
Score: 0.644
Data Source: STRINGDB
EXT2
Tbio
Family: Enzyme
Novelty: 0.0028975
Score: 0.641
Data Source: STRINGDB
ZSWIM6
Tbio
Novelty: 0.06512097
Score: 0.629
Data Source: STRINGDB
WNT11
Tbio
Novelty: 0.00674903
Score: 0.626
Data Source: STRINGDB
WNT3A
Tchem
Novelty: 0.00160727
Score: 0.616
Data Source: STRINGDB
HOXB13
Tbio
Family: TF
Novelty: 0.00783232
Score: 0.609
Data Source: STRINGDB
WNT5A
Tbio
Novelty: 0.00148207
Score: 0.603
Data Source: STRINGDB
Publication Statistics
PubMed Score  56.43

PubMed score by year
PubTator Score  49.24

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQ
1-70
QDLATPLESGAGARGSFNKFQPQPSTPQPQPPPQPQPQQQQPQPQPPAQPHLYLQRGACKTPPDGSLKLQ
70-140
EGSSGHSAALQVPCYAKESSLGEPELPPDSDTVGMDSSYLSVKEAGVKGPQDRASSDLPSPLEKADSESN
140-210
KGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQ
210-280
VRTHFSTAYELPLLTRAENYAQIQNPSWLGNNGAASPVPACVVPCDPVPACMSPHAHPPGSGASSVTDFL
280-350
SVSGAGSHVGQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKAKEHSAAISWAT
350-411
MNAETCVSYCESPAAAMDAYYSPVSQSREGSSPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQQDLATPLESGAGARGSFNKFQPQPSTPQPQPPPQPQPQQQQPQPQPPAQPHLYLQRGACKTPPDGSLKLQEGSSGHSAALQVPCYAKESSLGEPELPPDSDTVGMDSSYLSVKEAGVKGPQDRASSDLPSPLEKADSESNKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKRERFGQMQQVRTHFSTAYELPLLTRAENYAQIQNPSWLGNNGAASPVPACVVPCDPVPACMSPHAHPPGSGASSVTDFLSVSGAGSHVGQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMKAKEHSAAISWAT