You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
C11orf54
Ester hydrolase C11orf54

Protein Summary
Description
Exhibits ester hydrolase activity on the substrate p-nitrophenyl acetate.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000331239
  • ENSP00000331209
  • ENSG00000182919
  • ENST00000354421
  • ENSP00000346403
  • ENST00000528099
  • ENSP00000435113
  • ENST00000528288
  • ENSP00000433721
  • ENST00000540113
  • ENSP00000442094

Symbol
  • PTD012
  • PTOD012
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.22   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 56   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.22   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 56   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Protein-Protein Interactions (31)
1 – 10 of 31
CCT6A
Tbio
Novelty: 0.03886926
p_int: 0.7710588
p_ni: 0.2289412
Score: 0.564
Data Source: BioPlex,STRINGDB
CCT3
Tbio
Novelty: 0.00555442
p_int: 0.754042127
p_ni: 0.245957873
Score: 0.392
Data Source: BioPlex,STRINGDB
SERPINB5
Tbio
Novelty: 0.00088182
Score: 0.873
Data Source: STRINGDB
AKR1C2
Tchem
Family: Enzyme
Novelty: 0.00191717
Score: 0.871
Data Source: STRINGDB
GNPDA2
Tbio
Family: Enzyme
Novelty: 0.04593829
Score: 0.866
Data Source: STRINGDB
PGM2
Tbio
Family: Enzyme
Novelty: 0.01245335
Score: 0.823
Data Source: STRINGDB
SERPINB3
Tbio
Novelty: 0.00098929
Score: 0.809
Data Source: STRINGDB
ANXA7
Tbio
Novelty: 0.00218859
Score: 0.789
Data Source: STRINGDB
TAF1B
Tbio
Family: Enzyme
Novelty: 0.13655576
Score: 0.691
Data Source: STRINGDB
DCXR
Tbio
Family: Enzyme
Novelty: 0.00064186
Score: 0.679
Data Source: STRINGDB
Publication Statistics
PubMed Score  2.22

PubMed score by year
PubTator Score  1.1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MACAEFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLP
1-70
LVNQKKVYDLNKIAKEIKLPGAFILGAGAGPFQTLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGC
70-140
LLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLNFVTCMRETLEKHYGNKPIGMGGTFIIQ
140-210
KGKVKSHIMPAEFSSCPLNSDEEVNKWLHFYEMKAPLVCLPVFVSRDPGFDLRLEHTHFFSRHGEGGHYH
210-280
YDTTPDIVEYLGYFLPAEFLYRIDQPKETHSIGRD
280-315
MACAEFSFHVPSLEELAGVMQKGLKDNFADVQVSVVDCPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKVYDLNKIAKEIKLPGAFILGAGAGPFQTLGFNSEFMPVIQTESEHKPPVNGSYFAHVNPADGGCLLEKYSEKCHDFQCALLANLFASEGQPGKVIEVKAKRRTGPLNFVTCMRETLEKHYGNKPIGMGGTFIIQKGKVKSHIMPAEFSSCPLNSDEEVNKWLHFYEMKAPLVCLPVFVSRDPGFDLRLEHTHFFSRHGEGGHYHYDTTPDIVEYLGYFLPAEFLYRIDQPKETHSIGRD