You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FXYD6
FXYD domain-containing ion transport regulator 6

Protein Classes
Protein Summary
Description
This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes phosphohippolin, which likely affects the activity of Na,K-ATPase. Multiple alternatively spliced transcript variants encoding the same protein have been described. Related pseudogenes have been identified on chromosomes 10 and X. Read-through transcripts have been observed between this locus and the downstream sodium/potassium-transporting ATPase subunit gamma (FXYD2, GeneID 486) locus.[provided by RefSeq, Feb 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000260282
  • ENSP00000260282
  • ENSG00000137726
  • ENST00000524656
  • ENSP00000431427
  • ENST00000526014
  • ENSP00000433312
  • ENST00000527717
  • ENSP00000431446
  • ENST00000530956
  • ENSP00000463158
  • ENST00000539526
  • ENSP00000442756
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.87
gene perturbation
0.85
transcription factor perturbation
0.8
tissue sample
0.64
tissue
0.59


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.32   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 113   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.32   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 113   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
Cardiac conduction (R-HSA-5576891)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cardiac conduction
Reactome
Ion channel transport
Reactome
Ion homeostasis
Reactome
Ion transport by P-type ATPases
Reactome
Muscle contraction
Name
Explore in Pharos
Explore in Source
Cardiac conduction
Ion channel transport
Ion homeostasis
Ion transport by P-type ATPases
Muscle contraction
Gene Ontology Terms (7)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (44)
1 – 10 of 44
SLC39A12
Tbio
Family: Transporter
Novelty: 0.11255353
p_int: 0.999919243
p_ni: 0.000028334
p_wrong: 0.000052423
Score: 0.254
Data Source: BioPlex,STRINGDB
TSPAN31
Tdark
Novelty: 0.19615058
p_int: 0.999511943
p_ni: 0.000408032
p_wrong: 0.000080025
Data Source: BioPlex
ATR
Tchem
Family: Kinase
Novelty: 0.00246592
p_int: 0.999475451
p_ni: 0.000524549
Data Source: BioPlex
ATP12A
Tchem
Family: Transporter
Novelty: 0.00013675
p_int: 0.990399955
p_ni: 0.009600045
Data Source: BioPlex
DNM3
Tbio
Novelty: 0.03060558
p_int: 0.988765907
p_ni: 0.011233927
p_wrong: 1.66e-7
Data Source: BioPlex
ATRIP
Tbio
Novelty: 0.02462657
p_int: 0.987886372
p_ni: 0.011950425
p_wrong: 0.000163203
Data Source: BioPlex
COLEC12
Tbio
Novelty: 0.00845079
p_int: 0.985097215
p_ni: 0.01310567
p_wrong: 0.001797115
Data Source: BioPlex
BRAT1
Tbio
Novelty: 0.04085239
p_int: 0.975670539
p_ni: 0.024329461
Data Source: BioPlex
SPPL2B
Tbio
Family: Enzyme
Novelty: 0.03749833
p_int: 0.959807892
p_ni: 0.000026851
p_wrong: 0.040165257
Score: 0.186
Data Source: BioPlex,STRINGDB
CIP2A
Tbio
Novelty: 0.00948462
p_int: 0.952485952
p_ni: 0.047514048
Data Source: BioPlex
Publication Statistics
PubMed Score  18.32

PubMed score by year
PubTator Score  12.6

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR
1-70
APGDEEAQVENLITANATEPQKAEN
70-95
MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN