You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NAT10
RNA cytidine acetyltransferase

Protein Summary
Description
RNA cytidine acetyltransferase with specificity toward both 18S rRNA and tRNAs (PubMed:25411247, PubMed:25653167). Catalyzes the formation of N(4)-acetylcytidine (ac4C) at position 1842 in 18S rRNA (PubMed:25411247). May also catalyze the formation of ac4C at position 1337 in 18S rRNA (By similarity). Required for early nucleolar cleavages of precursor rRNA at sites A0, A1 and A2 during 18S rRNA synthesis (PubMed:25411247, PubMed:25653167). Catalyzes the formation of ac4C in serine and leucine tRNAs (By similarity). Requires the tRNA-binding adapter protein THUMBD1 for full tRNA acetyltransferase activity but not for 18S rRNA acetylation (PubMed:25653167). Can acetylate both histones and microtubules (PubMed:14592445, PubMed:17631499, PubMed:19303003). Histone acetylation may regulate transcription and mitotic chromosome de-condensation (PubMed:17631499). Activates telomerase activity by stimulating the transcription of TERT, and may also regulate telomerase function by affecting the b ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000257829
  • ENSP00000257829
  • ENSG00000135372
  • ENST00000531159
  • ENSP00000433011

Symbol
  • ALP
  • KIAA1709
  • ALP
  • Kre33
  • NET43
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
1
protein complex
1
molecular function
0.94
transcription factor binding site profile
0.93
histone modification site profile
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 75.36   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 189   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 75.36   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 189   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
Metabolism of RNA (R-HSA-8953854)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of RNA
Reactome
rRNA modification in the nucleus and cytosol
Reactome
rRNA processing
Reactome
rRNA processing in the nucleus and cytosol
Name
Explore in Pharos
Explore in Source
Metabolism of RNA
rRNA modification in the nucleus and cytosol
rRNA processing
rRNA processing in the nucleus and cytosol
Gene Ontology Terms (16)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-UniRule
Protein-Protein Interactions (394)
1 – 10 of 394
THUMPD1
Tbio
Novelty: 0.00148963
p_int: 0.998925479
p_ni: 0.001074521
Score: 0.993
Data Source: BioPlex,Reactome,STRINGDB
RPS2
Tbio
Novelty: 0.00679896
p_int: 0.997507267
p_ni: 0.002492733
Score: 0.187
Data Source: BioPlex,STRINGDB
RBM28
Tbio
Novelty: 0.01991731
p_int: 0.991757112
p_ni: 0.008242889
Score: 0.935
Data Source: BioPlex,STRINGDB
NOL10
Tdark
Novelty: 1.13860465
p_int: 0.989576331
p_ni: 0.010423669
Score: 0.996
Data Source: BioPlex,STRINGDB
HIST1H1T
Tdark
Novelty: 0.01211318
p_int: 0.970006474
p_ni: 0.029993526
Score: 0.165
Data Source: BioPlex,STRINGDB
RPS14
Tbio
Novelty: 0.0062093
p_int: 0.968970771
p_ni: 0.031029229
Score: 0.798
Data Source: BioPlex,STRINGDB
ZNF512
Tbio
Family: TF
Novelty: 0.19294377
p_int: 0.965122196
p_ni: 0.034877804
Data Source: BioPlex
H1FNT
Tdark
Novelty: 0.07619048
p_int: 0.960793707
p_ni: 0.039206293
Data Source: BioPlex
MECP2
Tchem
Family: TF
Novelty: 0.00058175
p_int: 0.8874271
p_ni: 0.1125729
Data Source: BioPlex
NOL12
Tbio
Novelty: 0.21688613
p_int: 0.865376668
p_ni: 0.134623332
Score: 0.637
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  75.36

PubMed score by year
PubTator Score  32.14

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MHRKKVDNRIRILIENGVAERQRSLFVVVGDRGKDQVVILHHMLSKATVKARPSVLWCYKKELGFSSHRK
1-70
KRMRQLQKKIKNGTLNIKQDDPFELFIAATNIRYCYYNETHKILGNTFGMCVLQDFEALTPNLLARTVET
70-140
VEGGGLVVILLRTMNSLKQLYTVTMDVHSRYRTEAHQDVVGRFNERFILSLASCKKCLVIDDQLNILPIS
140-210
SHVATMEALPPQTPDESLGPSDLELRELKESLQDTQPVGVLVDCCKTLDQAKAVLKFIEGISEKTLRSTV
210-280
ALTAARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIIQSLNPE
280-350
FNKAVIRVNVFREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKSLLGPYLVFMASTINGYEGTG
350-420
RSLSLKLIQQLRQQSAQSQVSTTAENKTTTTARLASARTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCL
420-490
NITRIVSGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAPAHHLFCLL
490-560
PPVPPTQNALPEVLAVIQVCLEGEISRQSILNSLSRGKKASGDLIPWTVSEQFQDPDFGGLSGGRVVRIA
560-630
VHPDYQGMGYGSRALQLLQMYYEGRFPCLEEKVLETPQEIHTVSSEAVSLLEEVITPRKDLPPLLLKLNE
630-700
RPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKD
700-770
FRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMD
770-840
MIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQ
840-910
EKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAG
910-980
PNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK
980-1025
MHRKKVDNRIRILIENGVAERQRSLFVVVGDRGKDQVVILHHMLSKATVKARPSVLWCYKKELGFSSHRKKRMRQLQKKIKNGTLNIKQDDPFELFIAATNIRYCYYNETHKILGNTFGMCVLQDFEALTPNLLARTVETVEGGGLVVILLRTMNSLKQLYTVTMDVHSRYRTEAHQDVVGRFNERFILSLASCKKCLVIDDQLNILPISSHVATMEALPPQTPDESLGPSDLELRELKESLQDTQPVGVLVDCCKTLDQAKAVLKFIEGISEKTLRSTVALTAARGRGKSAALGLAIAGAVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALQYQEHLDYEIIQSLNPEFNKAVIRVNVFREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKSLLGPYLVFMASTINGYEGTGRSLSLKLIQQLRQQSAQSQVSTTAENKTTTTARLASARTLYEVSLQESIRYAPGDAVEKWLNDLLCLDCLNITRIVSGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKNSPNDLQMLSDAPAHHLFCLLPPVPPTQNALPEVLAVIQVCLEGEISRQSILNSLSRGKKASGDLIPWTVSEQFQDPDFGGLSGGRVVRIAVHPDYQGMGYGSRALQLLQMYYEGRFPCLEEKVLETPQEIHTVSSEAVSLLEEVITPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLLKFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLTDEDEADQGGWLAAFWKDFRRRFLALLSYQFSTFSPSLALNIIQNRNMGKPAQPALSREELEALFLPYDLKRLEMYSRNMVDYHLIMDMIPAISRIYFLNQLGDLALSAAQSALLLGIGLQHKSVDQLEKEIELPSGQLMGLFNRIIRKVVKLFNEVQEKAIEEQMVAAKDVVMEPTMKTLSDDLDEAAKEFQEKHKKEVGKLKSMDLSEYIIRGDDEEWNEVLNKAGPNASIISLKSDKKRKLEAKQEPKQSKKLKNRETKNKKDMKLKRKK