You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IQCG
Dynein regulatory complex protein 9

Protein Summary
Description
Component of the nexin-dynein regulatory complex (N-DRC), a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes. Binds calmodulin when cellular Ca(2+) levels are low and thereby contributes to the regulation of calcium and calmodulin-dependent protein kinase IV (CAMK4) activity; contributes to the regulation of CAMK4 signaling cascades. Required for normal axoneme assembly in sperm flagella, normal sperm tail formation and for male fertility.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000265239
  • ENSP00000265239
  • ENSG00000114473
  • ENST00000455191
  • ENSP00000407736

Symbol
  • DRC9
  • DRC9
  • CFAP122
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.76
gene perturbation
0.64
transcription factor binding site profile
0.63
kinase perturbation
0.6
small molecule perturbation
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.34   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 64   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.34   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 64   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (10)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (62)
1 – 10 of 62
CALM2
Tclin
Novelty: 0.02810502
Score: 0.833
Data Source: STRINGDB
CALM3
Tclin
Novelty: 0.0082907
Score: 0.833
Data Source: STRINGDB
CALM1
Tclin
Novelty: 0.00331843
Score: 0.831
Data Source: STRINGDB
IQCD
Tdark
Novelty: 0.38709677
Score: 0.821
Data Source: STRINGDB
IQCA1
Tbio
Novelty: 0.15625
Score: 0.819
Data Source: STRINGDB
EFCAB2
Tdark
Novelty: 0.46545992
Score: 0.745
Data Source: STRINGDB
MEIG1
Tdark
Novelty: 1.55555556
Score: 0.712
Data Source: STRINGDB
EXOSC2
Tbio
Novelty: 0.04406904
Score: 0.668
Data Source: STRINGDB
CAMK4
Tbio
Family: Kinase
Novelty: 0.00536489
Score: 0.636
Data Source: STRINGDB
USP32
Tbio
Family: Enzyme
Novelty: 0.06653479
Score: 0.607
Data Source: STRINGDB
Publication Statistics
PubMed Score  5.34

PubMed score by year
PubTator Score  2.17

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEEDSLEDSNLPPKVWHSEMTVSVTGEPPSTVEEEGIPKETDIEIIPEIPETLEPLSLPDVLRISAVLED
1-70
TTDQLSILNYIMPVQYEGRQSICVKSREMNLEGTNLDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFA
70-140
VEFNKMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQALSKERENKMHFY
140-210
DIIAREEKGRKQIISLQKQLINVKKEWQFEVQSQNEYIANLKDQLQEMKAKSNLENRYMKTNTELQIAQT
210-280
QKKCNRTEELLVEEIEKLRMKTEEEARTHTEIEMFLRKEQQKLEERLEFWMEKYDKDTEMKQNELNALKA
280-350
TKASDLAHLQDLAKMIREYEQVIIEDRIEKERSKKKVKQDLLELKSVIKLQAWWRGTMIRREIGGFKMPK
350-420
DKVDSKDSKGKGKGKDKRRGKKK
420-443
MEEDSLEDSNLPPKVWHSEMTVSVTGEPPSTVEEEGIPKETDIEIIPEIPETLEPLSLPDVLRISAVLEDTTDQLSILNYIMPVQYEGRQSICVKSREMNLEGTNLDKLPMASTITKIPSPLITEEGPNLPEIRHRGRFAVEFNKMQDLVFKKPTRQTIMTTETLKKIQIDRQFFSDVIADTIKELQDSATYNSLLQALSKERENKMHFYDIIAREEKGRKQIISLQKQLINVKKEWQFEVQSQNEYIANLKDQLQEMKAKSNLENRYMKTNTELQIAQTQKKCNRTEELLVEEIEKLRMKTEEEARTHTEIEMFLRKEQQKLEERLEFWMEKYDKDTEMKQNELNALKATKASDLAHLQDLAKMIREYEQVIIEDRIEKERSKKKVKQDLLELKSVIKLQAWWRGTMIRREIGGFKMPKDKVDSKDSKGKGKGKDKRRGKKK