You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HAPLN2
Hyaluronan and proteoglycan link protein 2

Protein Summary
Description
Mediates a firm binding of versican V2 to hyaluronic acid. May play a pivotal role in the formation of the hyaluronan-associated matrix in the central nervous system (CNS) which facilitates neuronal conduction and general structural stabilization. Binds to hyaluronic acid (By similarity).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000255039
  • ENSP00000255039
  • ENSG00000132702

Symbol
  • BRAL1
  • BRAL1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.92
cell type or tissue
0.5
kinase perturbation
0.48
metabolite
0.45
chemical
0.44


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.75   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 74   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.75   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 74   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (6)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (114)
1 – 10 of 114
GLDN
Tbio
Novelty: 0.02153495
Score: 0.724
Data Source: STRINGDB
GFAP
Tbio
Novelty: 0.00029784
Score: 0.671
Data Source: STRINGDB
ARHGEF11
Tbio
Novelty: 0.02213023
Score: 0.626
Data Source: STRINGDB
WDR27
Tdark
Novelty: 1.10447279
Score: 0.619
Data Source: STRINGDB
PTPRZ1
Tbio
Family: Enzyme
Novelty: 0.00645203
Score: 0.617
Data Source: STRINGDB
TMEM235
Tdark
Novelty: 1.2
Score: 0.608
Data Source: STRINGDB
PSMB1
Tclin
Family: Enzyme
Novelty: 0.04143829
Score: 0.597
Data Source: STRINGDB
PDE10A
Tclin
Family: Enzyme
Novelty: 0.00336583
Score: 0.597
Data Source: STRINGDB
CNTN2
Tbio
Novelty: 0.00253901
Score: 0.588
Data Source: STRINGDB
NFASC
Tbio
Novelty: 0.00706267
Score: 0.581
Data Source: STRINGDB
Publication Statistics
PubMed Score  7.75

PubMed score by year
PubTator Score  4.96

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPGWLTLPTLCRFLLWAFTIFHKAQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRW
1-70
SKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVA
70-140
LTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLT
140-210
ARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYA
210-280
AWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN
280-340
MPGWLTLPTLCRFLLWAFTIFHKAQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRLEDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATYSQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN